Dataset for protein Bax of organism Cavia porcellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************                                                 **
MDGSGEHPRGSGPTSSEHIMKTGALLLQG-------------------------------------------------MI
                             fiqdragrmggdtlelamepapqdastkklgeclkrigdeldsnmelqr  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************************************                                     
AAVDTDSPREVFFRVAAEMFADGNFNWGRVVALFYFASKLVLK-------------------------------------
                                           alctkvpelirtimgwtldflrdrllswiqdqggwdg

       170       180       190  
....:....|....:....|....:....|..
                                
--------------------------------
llsyfgtptwqtvtifvagvltasltiwknmg
© 1998-2020Legal notice