Dataset for protein Bax of organism Cavia porcellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A286Y2U9_BAX-01      MDGSGEHPRGSGPTSSEHIMKTGALLLQGFIQDRAGRMGGDTLELAMEPA
A0A286Y2U9_BAX-02      MDGSGEHPRGSGPTSSEHIMKTGALLLQG---------------------
                       *****************************                     

A0A286Y2U9_BAX-01      PQDASTKKLGECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMF
A0A286Y2U9_BAX-02      ----------------------------MIAAVDTDSPREVFFRVAAEMF
                                                   **********************

A0A286Y2U9_BAX-01      ADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRDRLLS
A0A286Y2U9_BAX-02      ADGNFNWGRVVALFYFASKLVLK---------------------------
                       ***********************                           

A0A286Y2U9_BAX-01      WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKNMG
A0A286Y2U9_BAX-02      ------------------------------------------
                                                                 

© 1998-2020Legal notice