Dataset for protein BAX-like of organism Callorhinchus milii

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|K4FTK7_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Callorhinchus milii GN=BOK (length=213 residues).
MDMLRRSSVFAAEVMEVFERSPPDKELVSQAKALCRDYIHSRLIRAGIVWSKPECAAASPASKLTEVSAALLRLGDELEY
IRPNMYRNVAKQLNITVSSESIVSDAFLAVATEIFSAGITWGKVVALYAVAGGLAIDCVKQGQPAMVHTIVDCLGEFVRK
TLVTWLRRRGGWADITKSVVNNDPSIRDHWLVSAVCTFGHFVKAVFFFLLRER
>gnl|bcl2dbpro|V9L3D5_BAK1-01 BCL2-antagonist/killer 1 protein OS=[Eukaryota] Callorhinchus milii GN=BAK1 (length=215 residues).
MATWSSCDPCRSCSPHEEKSSEADAEQNMVKEAEDVFRNYVYQRYQTEVEERVQDGFVTPAMQEMTVQQQSGLSSTMQIG
RQLAVIGDEINQRYKWEFRSVLAWNALTLENIFESFCSVAERLFDAGINWGQIIALLSFGYRMSIYIHQRGILGFFGRIA
KYVAKFIWKNQIAQWIMAQGGWTAAFSVENASLKYLCGIVAVVVLGVAIAHGVYK
© 1998-2020Legal notice