Dataset for protein BAX-like of organism Callorhinchus milii

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K4FTK7_BOK-01       ------MDMLRRSSVFAAEVMEVFERSPPDKELVSQAKALCRDYIHSRL-------IRAG
V9L3D5_BAK1-01      MATWSSCDPCRSCSPHEEKSSE----ADAEQNMVKEAEDVFRNYVYQRYQTEVEERVQDG
                           *  * .* .  :  *    : .::::*.:*: : *:*::.*        :. *

K4FTK7_BOK-01       IVWSKPECAAASPASKLT---EVSAALLRLGDELEYIRPNMYRNVAKQLNITVSSESIVS
V9L3D5_BAK1-01      FVTPAMQEMTVQQQSGLSSTMQIGRQLAVIGDEINQRYKWEFRSVLAWNALTLEN---IF
                    :* .  :  :..  * *:   ::.  *  :***::    . :*.*  .  :*:..   : 

K4FTK7_BOK-01       DAFLAVATEIFSAGITWGKVVALYAVAGGLAIDCVKQGQPAMVHTIVDCLGEFV-RKTLV
V9L3D5_BAK1-01      ESFCSVAERLFDAGINWGQIIALLSFGYRMSIYIHQRGILGFFGRIAKYVAKFIWKNQIA
                    ::* :**  :*.***.**:::** :..  ::*   :.*  .:.  *.. :.:*: .: :.

K4FTK7_BOK-01       TWLRRRGGWADITKSVVNNDPSIRDHWLVSAVCTFGHFVKAVFFFLLRER
V9L3D5_BAK1-01      QWIMAQGGW---TAAFSVENASLKYLCGIVAVVVLGVAIAHGVYK-----
                     *:  .***   * :.  ::.*:.    : ** .:*  :   .:      

© 1998-2020Legal notice