Dataset for protein BAX-like of organism Callorhinchus milii

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W3KFA8_BAX-01       --------------------------------------------------
A0A4W3JNU0_BAX-02       --------------------------------------------------
A0A4W3JNU0_BAX-01       --------------------------------------------------
A0A4W3JFN9_BAX-01       MKGPRVRESSDSLDATRKLPAITQSCLVVLEVFSWLFKLKSSRGFTIAEF
A0A4W3KJU8_BAK1-03      -------MSPESSSLTFRSTKKTLPSVVLVAQQYNIIKVQSV--------
A0A4W3JVN7_BAK1-01      --------------------------------------------------
A0A4W3KJU8_BAK1-01      --------------------------------------------------
A0A4W3IZA3_BOK-01       ------------------------------------------MSDLAGLM
K4FTK7_BOK-01           --------------------------------------------------
                                                                          

A0A4W3KFA8_BAX-01       --------------------------------------------------
A0A4W3JNU0_BAX-02       --------------------------------------------------
A0A4W3JNU0_BAX-01       --------------------------------------------------
A0A4W3JFN9_BAX-01       AVTLHRLCGGGCGVGVCGRGSAMESFRASGAADGRLS----------REE
A0A4W3KJU8_BAK1-03      ---------------VRGKAPSSNCVRNSQGPLNDFAFICLLFLSELMTL
A0A4W3JVN7_BAK1-01      ----------------MASGGDGDPFRSNLPRNRKNL------------H
A0A4W3KJU8_BAK1-01      ----------------MATWSSCDPCRSCSPHEEKSS------------E
A0A4W3IZA3_BOK-01       LSIFGVPVTGLIILISHLLSSQMDMLRRSSVFAAEVM------------E
K4FTK7_BOK-01           ----------------------MDMLRRSSVFAAEVM------------E
                                                                          

A0A4W3KFA8_BAX-01       ----------------------FIMERLSRS----TEQFGVSLANLGPFP
A0A4W3JNU0_BAX-02       --------------GFRSRVDGFIMDRTQRG----AEDCEVLVTVSDLGG
A0A4W3JNU0_BAX-01       ----------------------FIMDRTQRG----AEDCEVLVTVSDLGG
A0A4W3JFN9_BAX-01       GDRAPDSSDEILMRQAGGLMRRFVLETIHEEDPE------ISLSPDELGG
A0A4W3KJU8_BAK1-03      QSVYFPPTEQNMVKEAEDVFRNYVYQRYQTEVEERVQDGFVTPAMQEM-T
A0A4W3JVN7_BAK1-01      RRPSRPVTEEGVVQETEEVFRSYVFFRYQTER---EEGGNVPEDPEIA-E
A0A4W3KJU8_BAK1-01      ----AD-AEQNMVKEAEDVFRNYVYQRYQTEVEERVQDGFVTPAMQEM-T
A0A4W3IZA3_BOK-01       VFERSP-PDKELVSQAKALCRDYIHSRL-------IRAGIVWSKPECA-A
K4FTK7_BOK-01           VFERSP-PDKELVSQAKALCRDYIHSRL-------IRAGIVWSKPECA-A
                                              ::                :         

A0A4W3KFA8_BAX-01       QDTGTAHPHLKGMSDSLRRIGDLLSNDTKLQ----QGIAHMS-DC---SK
A0A4W3JNU0_BAX-02       RADELNKPCLKRLGVCLRQIGDELDGNVELQ----RMINRISTSC---PK
A0A4W3JNU0_BAX-01       RADELNKPCLKRLGVCLRQIGDELDGNVELQ----RMINRISTSC---PK
A0A4W3JFN9_BAX-01       TQSEIDDPTIKHVTQCLRTIGDELNRNVELQ----CLIDSIPINS---AR
A0A4W3KJU8_BAK1-03      VQQQSGLSSTMQIGRQLAVIGDEINQRYKWEFRSVLAWNALTLEN---IF
A0A4W3JVN7_BAK1-01      MHQSPEST-TALVGRQLAVIGDDINRRYDLEFHNLLSTLPLNAEN---AY
A0A4W3KJU8_BAK1-01      VQQQSGLSSTMQIGRQLAVIGDEINQRYKWEFRSVLAWNALTLEN---IF
A0A4W3IZA3_BOK-01       ASPASKLT---EVSAALLRLGDELEYIRPNMYRNVAKQLNITVSSESIVS
K4FTK7_BOK-01           ASPASKLT---EVSAALLRLGDELEYIRPNMYRNVAKQLNITVSSESIVS
                               .    :   *  :** :.               :  .      

A0A4W3KFA8_BAX-01       ETFFKVAEEVFSDGVVNWGRVVMLFIFACILVLKALTQSIPNIIQTVISW
A0A4W3JNU0_BAX-02       ETFFQVAKELFSDGVINWGRVVTLFYFACKFVVKAVCQKLPELIQTIITW
A0A4W3JNU0_BAX-01       ETFFQVAKELFSDGVINWGRVVTLFYFACKFVVKAVCQKLPELIQTIITW
A0A4W3JFN9_BAX-01       DVLCQVAGKLISDE-LNWGRIVSFFYFAGKLIYKALMQNLRGMIQPIINW
A0A4W3KJU8_BAK1-03      ESFCSVAERLFDAG-INWGQIIALLSFGYRMSIYIHQRGILGFFGRIAKY
A0A4W3JVN7_BAK1-01      DYFRKIALGLFESG-INWGRVIALLGFGYRMALYVFQRGIKGFISQIAKF
A0A4W3KJU8_BAK1-01      ESFCSVAERLFDAG-INWGQIIALLSFGYRMSIYIHQRGILGFFGRIAKY
A0A4W3IZA3_BOK-01       DAFLAVATEIFSAG-ITWGKVVALYAVAGGLAIDCVKQGQPAMVHTIVDC
K4FTK7_BOK-01           DAFLAVATEIFSAG-ITWGKVVALYAVAGGLAIDCVKQGQPAMVHTIVDC
                        : :  :*  ::.   :.**.:: :  ..  :      .    :.  :   

A0A4W3KFA8_BAX-01       TMEFM-QRYVLQWIQNHGGWVSDHLTTTTTNYIAIYAALFTPGQVRTTQG
A0A4W3JNU0_BAX-02       TLEYI-QENILQWIREHGGW-DAILGTPTWQTVSI----FILGVITTLVV
A0A4W3JNU0_BAX-01       TLEYI-QENILQWIREHGGW-DAILGTPTWQTVSI----FILGVITTLVV
A0A4W3JFN9_BAX-01       SLDFI-QNRVVPWIQLQGGW-ENIYSYFGTPTWQMFAV--------FSAS
A0A4W3KJU8_BAK1-03      VAKFIWKNQIAQWIMAQGGW-VSMQCSVAAYYYTIMHIIIQLHNKLFIAY
A0A4W3JVN7_BAK1-01      VAEFVLRNRIARWIAAQGGW----VAALDLDNVYMKWMAGILAVVLMGVF
A0A4W3KJU8_BAK1-01      VAKFIWKNQIAQWIMAQGGW----TAAFSVENASLKYLCGIVAVVVLGVA
A0A4W3IZA3_BOK-01       LGEFV-RKTLVTWLRRRGGW-ADITKSVVNNDPSIRDHWLVSAVCTFGHF
K4FTK7_BOK-01           LGEFV-RKTLVTWLRRRGGW-ADITKSVVNNDPSIRDHWLVSAVCTFGHF
                          .:: .  :  *:  .***              :               

A0A4W3KFA8_BAX-01       AYILI-------
A0A4W3JNU0_BAX-02       VRWKS-------
A0A4W3JNU0_BAX-01       VRWKS-------
A0A4W3JFN9_BAX-01       IITGVLALMKLT
A0A4W3KJU8_BAK1-03      LINDQIKMDPV-
A0A4W3JVN7_BAK1-01      VIHKFYRP----
A0A4W3KJU8_BAK1-01      IAHGVYK-----
A0A4W3IZA3_BOK-01       VKAVFFFLLRER
K4FTK7_BOK-01           VKAVFFFLLRER
                                    

© 1998-2020Legal notice