Dataset for protein BAX-like of organism Callorhinchus milii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------d--r-s-
mkgprvrmssesssltrrstkktqssvvvvevqywlikvqsvrsftiglmlvtlhvpvtgliivivmgtgssm-pl-s-s
       e pd lda fklpai lpcl llaqfsnif lk smgdlaaefasifgrlcg gcglgsraswpqsnmf rnq
                                                                  hlrsgdgesv ncl
                                                                  c la ac cc a g
                                                                    k           
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          ::                :                .  
-------------------e-----p------v-qae-vfr-yimsryqte----vedgivwvapeel-gvqqesnlp-t
vfaakvsficllflselrt-vfers-vteqnl-se--dl--nfvyqtl-r-veeriracfitstvsdagtrspqlkktsl
prnresm          melrsvyrdspdkemmk-tka-cdd  he ts-grp  aq--e spkmqcmfaaadatgssc-
gplnrnl            hqrrsp ps eiv rgfrsrv s  ld ihesd   --qf- llsnlip pthtspeh ti
ahegdla             gdpaf  a  g  q  gg m r  ff         t g n ped dg  eqdsgidd 
 ade f                  a            e   g             e   g          m    a    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :   *  :** :.               :  .      : :  :*  ::.   :.**.:: :  ..  :      .  
krvgrqLrviGDelnyryklq----lminritvss---vketffqvAeelfsdg-inWGrvvalfyfayrlvikavqqgi
-qlsvc arl  liernvewefrnvrkwlnlstenesipsdslcsi triidaevvt  qiitflsvggkmavyilkrkl
meitaa lq   d dqirpnmyhslaaqdamplnc   if a lk  kkes  l   k  s ya  cgfsldchc sq
alm qs  t     sgdtd      qstas n-d    ay y ra  lg             m  i   i iy vft 
 h  d          n         cl  p  i     sr v                     g          m   
 g                        g  h  a                                               
                                                                                

       250       260       270       280       290       300       310  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
  :.  :     .:: .  :  *:  .***              :                           
pgmiqtiikwvlefi-qntivqWiraqGGW--ditktvtwntvsi----filavvtfgvfviwkf-------
lefvhrvatytakyvwrkrvlt lqrh   vd--lgspvtqypymrdhwlvsg-iltlhvirhvvykllrer
ralfgq vdclgd mlkeqlar  mer    aamyaafsnynytlkavlg---qc-mtaylkagsffpmpvt
kni sp  sfsm     rn  p  an     vshvtytgvpdwq yymi-tvhn-vlsqsaytlqlrmdkl 
        n         y      l     sn qs ldle ia mwlciqp  kr i g andiia     
                               e   c  aad a  fhia          a  i         
                                               a                        
© 1998-2020Legal notice