Dataset for protein classical BH3-containing proteins of organism Terrapene carolina triunguis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A674I2R9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Terrapene carolina triunguis GN=BAD (length=141 residues).
MFRIQEFPDEVFPGRGKESPLPPESQRGHTPGSKQPDTPTAEVRSRIGSDPPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAWLGHRPARDAPPRSSK
>gnl|bcl2dbpro|A0A674IAI8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Terrapene carolina triunguis GN=BCL2L11 (length=203 residues).
MAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGEGDFTQQPSGSSSPSSPQGPFAPPSSPSPFA
TRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSVREDMQPEIWIAQEL
RRIGDEFNASYCPRRGFLDNPAVNHQIVLRLLRSIIRLIWRLQ
>gnl|bcl2dbpro|A0A674IPL3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Terrapene carolina triunguis GN=BMF (length=192 residues).
MDPPSYLEEDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREARTEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFLHNLALNVEANRNNVGQR
>gnl|bcl2dbpro|A0A674JUE0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Terrapene carolina triunguis GN=PMAIP1 (length=51 residues).
VRGTKFGSRFEPPPTQEAVMQCSLQLRKIGDICNLQQKILNVITKLFCPGT
© 1998-2020Legal notice