Dataset for protein classical BH3-containing proteins of organism Terrapene carolina triunguis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A674I2R9_BAD-01       ----------------------------------------------MFRI
A0A674IAI8_BCL2L11      MAKQSSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHSGE
A0A674IPL3_BMF-01       --------------------------------MDPPSYLEEDYSSLDGLD
                                                                          

A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A674I2R9_BAD-01       QEFPDEVFPGRGKESPLPPES-----------------------------
A0A674IAI8_BCL2L11      GDFTQQP---SGSSSPSSPQGPFAPPSSPSPFATRSPLFIFVRRSSLLSR
A0A674IPL3_BMF-01       DDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIR
                                                                          

A0A674JUE0_PMAIP1-      --------VRGTKFGSRFEPPPTQEAVMQC--------------------
A0A674I2R9_BAD-01       --------QRGHTPGSKQPDTPTAEVRSRIGSDPPSLE------------
A0A674IAI8_BCL2L11      SSSGYFSFDTDRSPAPMSCDKSTQTPSPPC----QAFNHYLSAMASRWES
A0A674IPL3_BMF-01       HAE-----QQDKATQTLSPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHV
                                  .    .     .*                           

A0A674JUE0_PMAIP1-      ----------------------------SLQLRKIGDICNLQQ-------
A0A674I2R9_BAD-01       PEVQDEPGGAFRARSRSAPPILWAAMRYGRELRRMSDEFDVALQVLPRPK
A0A674IAI8_BCL2L11      PSVREDMQP---------------EIWIAQELRRIGDEFNASY----CPR
A0A674IPL3_BMF-01       PPVGFALNPHLQEEPREGQREARTEVQIARKLQCIADQFHRLH----IQR
                                                    . :*. :.*             

A0A674JUE0_PMAIP1-      ---------------KILNVITKLFCPGT---------
A0A674I2R9_BAD-01       SAGTTSQLHRGNSWKETLQAW--LGHRPARDAPPRSSK
A0A674IAI8_BCL2L11      RGFLDNPAVNHQIVLRLLRSIIRLIWRLQ---------
A0A674IPL3_BMF-01       -----HQQNRNQVWWQILLFLHNLALNVEANRNNVGQR
                                         *     *              

© 1998-2020Legal notice