Dataset for protein classical BH3-containing proteins of organism Terrapene carolina triunguis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                mda ssieed qglhglegevphqp ggs qpgems psi apnq p 
                                              dfgdd  fded   r ke  lp e          

        90       100       110       120       130       140       150       160
                              .    .     .*                                     
plltrsqlfplvrrssplsrsssgyfsfvtdrstqtmqessp atpsprigvtpqsqrlyysnmgyrwhv-s-rfepq-h
cfag fp  ifthccglgi hae     dq kkfaplfcpp   darmq  sdepplnhflgaaas les p qedmnga
                               ha   k   k     ml      eafe             e gdalg  

       170       180       190       200       210       220       230        
                  . :*. :.*                              *     *              
lrersrsgqrilwt-vw-sqq qkms qchrqqqvlpr--sggtts-qv-n-v-wqt qswtr glppqrnrppvssr
fqaep eappearaamryglk  c a i dlll    iqkrafldnplnnhnsvlkl nflin fhnleadannrgqk
               iq             aah    c       h ah g i ke  la hk ac ga         
© 1998-2021Legal notice