Dataset for protein classical BH3-containing proteins of organism Piliocolobus tephrosceles

[Download (right click)] [Alignment] [Repertoires]

15 sequence(s)

>gnl|bcl2dbpro|A0A8C9GX27_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BBC3 (length=269 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRVSAGG
GVDGRWDFPPEEGAAGGPRQMCCSCCPARLGRSADRQVGGEWVGGIARPQSRPGTPRRGWHSRSPSQGQGQGRELGCRGD
QRRARSPRPRGLRASLGGAAHISRAIYSW
>gnl|bcl2dbpro|A0A8C9H6M4_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=PMAIP1 (length=139 residues).
MPGKKARKNAQPSPARAQAGAGTAGTARDQAGFGIGMQLHFTRGKNLLSSSPLALSSSPLALPRGHEEQVQVARSRVCYS
TQEIWRQTEFPAETSESDSQTLLLRNLTESKTCIRGLQKRIFLRRCTFHQFEARLHCNW
>gnl|bcl2dbpro|A0A8C9H6M4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=PMAIP1 (length=132 residues).
HRGSSHWTKAWSLALGPHSFPGTHRVYLVALRVRVVGPGTPARGSVGVQLASCRRPTRSSWRPRFPGSVAEWAAALAEMP
GKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A8C9HAT1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPVGDRPSDSGKYHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|A0A8C9HAT1_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPVGDRPSDSGKYHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSESEDSENPSA
RMLAEASAGMSASATDSEAQHAENVKLEALGLWRPEVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASS
GG
>gnl|bcl2dbpro|A0A8C9HKG2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BIK (length=171 residues).
MPFRPQSRIPRSGCERLLPGRGGEGPGRGGRGGAPGPIRSRAGSRAVDTKLLRWLTDAASIAAASDMLALQLACIGDEMD
VSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALLLLLALLLA
LLSGGLHLLLK
>gnl|bcl2dbpro|A0A8C9HKG2_BIK-03 BCL2-interacting killer protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALQLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A8C9HKG2_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BIK (length=281 residues).
MPFRPQSRIPRSGCERLLPGRGGEGPGRGGRGGAPGPIRSRAGSRAVDTKLLRWLTDAASIAAASDMLALQLACIGDEMD
VSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVRAFRFLTLTGSAASGGCQ
SCSSGRHSPHHSLSSAVSSLSTSAWSHRLLSLGFLVMSAQTSAWSWVSLWPESLHLADRILVSSPGQRPPEQPSWQPGPI
LHCPPPGQLIALTCVHPLPVSHRLAAAGLFGHVLRATFPLS
>gnl|bcl2dbpro|A0A8C9I5G9_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKL
LASST
>gnl|bcl2dbpro|A0A8C9I5G9_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDMGD
TSLWFGFIFTGLDLYGHHHSQDTEQLNHRDFS
>gnl|bcl2dbpro|A0A8C9I5G9_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A8C9I5G9_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A8C9I5G9_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A8C9I5G9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A8C9LTX9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BMF (length=204 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMSL
© 1998-2022Legal notice