Dataset for protein classical BH3-containing proteins of organism Piliocolobus tephrosceles

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       .                                        
------------dregrqlqpaerppqlrpga--slqlepq--geg----g----p------------sp---at-s-l-
makqpsdvssec-----pfr-ssqedrsgae-pt--rtlasgv---phgg-gdsc-gpsplgplappa--gpf--v-p-l
  me  rcverlmfqipe-erq-gi-sasc-rspltgggsgrnpdrnsrseryhaqhgglqwdvplashrqgspardthf
        ma arspvm-p-k-i--s----rsglghl v rpgsgwsgdpqlhgrratprvlss yirrqaeqrpptskh
            eqg svis vdlmetdqyqqfa gd t lwtlcfllem kgft  kna yla  vvdvvapllsrrgs
             md ksa  na lap l  p   aa s htqka gial paaf  ah  sg   rtast lgdlmgdq
             d   k   e    g           f  sme   c                  ll  s dc  aeae
                     d                   dla                       c  e      a  
                                         a                                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---r--s-------g--sd--drslapmscdkstqtpsppcqafnhylsamagrr------------------------r
igm-ws-llsssss-yf--mtalqp-cagdemdvslraerlaqlsevamh-lsl-qaepadmpavlpigeqpptpriydq
gfvqrltprerrptaasefdl----y-i-----aem----se-agrp-l-s---arplv tf           egfaqr-
vqplvardaacyritsawrpstptsvl-wasql---tgsva-s--q-t-lapvywl    sa             qwrty
l latygcsvgl rrevptrrrqm seeethlgspveekt-rlrq-tsygpvnv                     gnlhe
e r lpdspra  pqpr nqpqhg ga  qgeeemf dgktpkpensrqen  i                     agee 
     hcggp    mdq  kaf       paa  ga caeg hnaglkp                           e a 
     f        e i  g                      fd   f                                
                d                         e                                     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :                                                                    
-eiriaqelrrigde--fnayyarrlrl-rsqsag---------------------------------------------
ptde-rrvsqsfm-gsnlttlk---m-fwlhpnp-srvqmvilrllryiarlgwrmhnssgrrsptwslsscvtslstsl
w--dw-dqpepmaktll-rr--fni-f-nny---edhpwwrwrlfstnsvasvgeqscga phplhhnggraqsl kgra
lgv-skt-idgl- sifw-gfpehqveky-pcasttttrlqrfftphgl ln ecnr                       
aarqlg-s ae v r  ak-ctltnfsarq-vtwrqgsdgnhddp eeg  g                            
  kgc am  d q q   fqai lg qyqprsqtqnae af                                       
       k  c   k   a       ivpgflhn g                                            
       c      d           h l dk g                                              
                          d k ah                                                
                          a e                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
wsrrqvslgllvllaltsdwswlallsgglhlplkrpvtsrrqwpsrspswqqgqirhlpprgqqrrltsvrprpvshsl
mqmemslsatrlrsswsaarqlvsnwvrsssrlssilgsppggrhpeq  qgp pglecgcp dliaarcph lglrar 
 plqllcgwfpamqgr     vgre pe iaaaqr                                             
 dhaac  cc  f  q      dg  g      dq                                             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       330       
....:....|....:..
                 
-----------------
ggaglisrvlyswfpls
aa ahfghairat    
                 
                 
                 
                 
                 
                 
                 
© 1998-2022Legal notice