Dataset for protein classical BH3-containing proteins of organism Piliocolobus tephrosceles

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------dregrqlqpaerppqlrpga----qlepq--------------p------------sp----t-s-l-
makqpsdvssec-----pfe----e-rsg-e-ptslrt--sgvgegphgggkdsc-hpspqgplappa--gpfpav-s-l
  me  rcverlmfqip---rssq-d---c-rsplg--la-rnpdrnsrsegyhaqaggllwdg yirhraesa-rdpkf
        ma arsgvmepr qigiesdsarsfl ag g gpgsmplgdprrggr gaprvlga gasgqqgqrpswthh
            eqd svis vdlmataqy q    l v ltmlc gkka lnaq s aaaqa   vtdttrdtkptriq
             d   s   e  l g l  p    d f  sle   ce   a             tcasshwqdlmgdg
                     d                   a                        l   eapl gfeaa
                                                                  h      c a a  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---r------s---ga-sd--drslapmsceksvqtpsppcqafnhylsa---------------------masrrqalp
igp-wssllsrsss--f--mtalqp-cagddmdtslrasrlaqls-v---slglarpevataptpfiydqwtddi-dver
gfmhrltgae-lyiaylefds-p--y-i--seg--va------pte-amhapnvw          rgrry -rgwgr---
lqlltfrptalvrrvparvrlv-tstl-rt---sp--rgvvpyagrstygp   r          geqer r-e- -ssd
m rasypdsrgrpptsvptsvtqpgsereqhvqemmteeeter--nprqe               aae   qs-y prpa
    ftgcppc  lsesanppshmal   pgqeagaedc sclsqglkl                      nkil lqf 
     pd kna   mdr lkargl g   h l     ca g hre  f                       ge   ap  
     hc gh    e q  g q       g          a f                            a     m  
                d            a            e                                     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
afm-----------------rpgiri-------------------------------------------arelrrig---
sd-dgfttlkeniprfwrspnaesvvrgrwfltptgsaasggcqscssgrhsphhslssavsslstsawsqrqvslallv
--vpswaaaptepmqytwrkssqvstdafrdfpleeg  g                             lmamsls-vel
rsfaevnrilaqm gkqspv---tqs                                           qhqatc-wtws
pma dllp g  f egkaqst  qlp                                           pen q-tsfrf
g   aakg      aee eld  phl                                           d k legecpc
e                  h   gg                                              d gd c  a
                        a                                                c      
                                                                         a      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------defnayyarrlhll-----------------------------------------------------------
llaltgl--wlrllsggvsqplkrlwcswtqwpsrspswgqgnyraagprpqmvilrllrylvrlvwrmhaglisrvlys
rtswrsfwqlg--wv---fknsakvvwqrrlrlpnqalqqpeprqstedhgltwrgtsvqpipvsrslsl ahfghaira
msqrsrdrs--snr-qtte--rsiphtpplgfhhel  n e qishlscp dqrnagrphtrllrhrmgg          
kqiq aaqlyvnhhressarfqr  gsnig            lhngfp    lia  cc   gkgal aa          
gfgi   gkvihf-qcqm-naiq  f  g              glec                                 
f cf    drhge p kiqa en                    d d                                  
a        kdf  g dhl  d                     a                                    
                 f                                                              

     
....:
     
-----
wfpls
t    
     
     
     
     
     
     
© 1998-2023Legal notice