Dataset for protein classical BH3-containing proteins of organism Piliocolobus tephrosceles

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9H6M4_PMAIP1-      -------------MPGKKARKNAQPSPARAQAGAGTAGTARDQAGFGIGM
A0A8C9H6M4_PMAIP1-      -----------------------------------HRGSSHWTKAWSLAL
A0A8C9HKG2_BIK-03       ------------MSGVRPISRDILMETLLYEQ----LLEPLTME------
A0A8C9HAT1_BAD-01       ------------MFQIPEFEPSEQEDSSSAER----GLGPSPVGDRPSDS
A0A8C9HAT1_BAD-02       ------------MFQIPEFEPSEQEDSSSAER----GLGPSPVGDRPSDS
A0A8C9GX27_BBC3-01      --------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEP
A0A8C9HKG2_BIK-01       ----------------MPFRPQSRIPRSGCE-----RLLPGRGGEGPGRG
A0A8C9HKG2_BIK-02       ----------------MPFRPQSRIPRSGCE-----RLLPGRGGEGPGRG
A0A8C9LTX9_BMF-01       --MEPSRCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD-----
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                                                               .          

A0A8C9H6M4_PMAIP1-      QLHFTRGKNLLSSSPLALSSSPLALPRGHEEQVQVARSRVCYSTQEIWRQ
A0A8C9H6M4_PMAIP1-      GPHSFPGTHRVYLVALRVRVVGPGTPARGSVGVQLASCR--RPTRSSWRP
A0A8C9HKG2_BIK-03       ----------VLG---VTDPEEDLDPMED------FDPLEC---MEDSDM
A0A8C9HAT1_BAD-01       GKYHRQAPGLLWD---ASHQQEQPTSSSHHGG--------A---GAVETR
A0A8C9HAT1_BAD-02       GKYHRQAPGLLWD---ASHQQEQPTSSSHHGGRAWYSPSES---EDSENP
A0A8C9GX27_BBC3-01      GLAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDG
A0A8C9HKG2_BIK-01       GRGGAPGP--------IRSRAGSRAVDTKL--LRWLTDAAS--IAAASDM
A0A8C9HKG2_BIK-02       GRGGAPGP--------IRSRAGSRAVDTKL--LRWLTDAAS--IAAASDM
A0A8C9LTX9_BMF-01       -----------------------CPLSRLQLFPLTHCCGPGLRPTSQEDK
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A8C9H6M4_PMAIP1-      -------------TEFPAETSESDSQTLLL--------------------
A0A8C9H6M4_PMAIP1-      RFPGSVAEWAAALAEMPGKKARKNAQPSPA--------------------
A0A8C9HKG2_BIK-03       LALQLACIGDEMDVSLRAPRLAQLSEVAMHSLGLA---------------
A0A8C9HAT1_BAD-01       SRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLW---------------
A0A8C9HAT1_BAD-02       SARMLAEASAGMSASATDSEAQHAENVKLEALGLWRPEVATA--------
A0A8C9GX27_BBC3-01      PQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVR---------------
A0A8C9HKG2_BIK-01       LALQLACIGDEMDVSLRAPRLAQLSEVAMHSLGLA---------------
A0A8C9HKG2_BIK-02       LALQLACIGDEMDVSLRAPRLAQLSEVAMHSLGLA---------------
A0A8C9LTX9_BMF-01       ATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGE
A0A8C9I5G9_BCL2L11      -------------------------------ASRRQAEPADM--------
A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVI----------------
A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM--------
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM--------
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM--------
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADM--------
                                                                          

A0A8C9H6M4_PMAIP1-      -----RNLT----ESKTCIRGLQKRIFLRRCTFHQFEARLHCNW------
A0A8C9H6M4_PMAIP1-      -----RAQAELEVECATQLRRFGDKLNFRQ-KLLNLIAKLFCSGT-----
A0A8C9HKG2_BIK-03       -----FIYDQ-TDDIRDVLRSFMDG--FTTLKENIMRFWRSPNPGSRV--
A0A8C9HAT1_BAD-01       -----AAQRY-GRELRRMSDEFVDS--FKGLP-------RPKSAGTAT--
A0A8C9HAT1_BAD-02       --PTPRGRRR-TKGWRRSPAPF--G--AARAP-------RPLTSGQHS--
A0A8C9GX27_BBC3-01      -----GEEEQWAREIGAQLRRMADD--LNA------QYERRVSAGGGVDG
A0A8C9HKG2_BIK-01       -----FIYDQ-TDDIRDVLRSFMDG--FTTLKENIMRFWRSPNPGSRV--
A0A8C9HKG2_BIK-02       -----FIYDQ-TDDIRDVLRSFMDG--FTTLKENIMRFWRSPNPGSRVRA
A0A8C9LTX9_BMF-01       QPPEGQWQHRAEVQIARKLQCIADQ-------FHRLHVQQHQQNRNRVWW
A0A8C9I5G9_BCL2L11      ---------RPEIRIAQELRRIGDE--FNAYYARRLAKLLASST------
A0A8C9I5G9_BCL2L11      ------------------LEDMGDTSLWFGFIFTGLDLYGHHHSQDTEQL
A0A8C9I5G9_BCL2L11      ---------RPEIRIAQELRRIGDE--FNAYYARRVFLNNYQAAEDHPQM
A0A8C9I5G9_BCL2L11      ---------RPEIRIAQELRRIGDE--FNAYYARRVFLNNYQAAEDHPQM
A0A8C9I5G9_BCL2L11      ---------RPEIRIAQELRRIGDE--FNAYYARRLEK------------
A0A8C9I5G9_BCL2L11      ---------RPEIRIAQELRRIGDE--FNAYYARRMSLPPD---------
                                             :                            

A0A8C9H6M4_PMAIP1-      --------------------------------------------------
A0A8C9H6M4_PMAIP1-      --------------------------------------------------
A0A8C9HKG2_BIK-03       -----------------------------------------SREQVLLAL
A0A8C9HAT1_BAD-01       -----------------------------------------QMRQSSSWT
A0A8C9HAT1_BAD-02       -----------------------------------------DMAASSGG-
A0A8C9GX27_BBC3-01      RWDFPPEEGAAGG----------------------------PRQMCCSCC
A0A8C9HKG2_BIK-01       -----------------------------------------SREQVLLAL
A0A8C9HKG2_BIK-02       FRFLTLTGSAASGGCQSCSSGRHSPHHSLSSAVSSLSTSAWSHRLLSLGF
A0A8C9LTX9_BMF-01       QILLFLHNLALNGEENRNGAGPRPLTWNGGRCQTLLKGRLMSL-------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      NHRDFS--------------------------------------------
A0A8C9I5G9_BCL2L11      VILRLLRYIVRLVWRMH---------------------------------
A0A8C9I5G9_BCL2L11      VILRLLRYIVRLVWRMH---------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
                                                                          

A0A8C9H6M4_PMAIP1-      --------------------------------------------------
A0A8C9H6M4_PMAIP1-      --------------------------------------------------
A0A8C9HKG2_BIK-03       LLLLAL-----LLALLSGGLHLLLK-------------------------
A0A8C9HAT1_BAD-01       RVFQSW-----WDRNLGRGSSAPSQ-------------------------
A0A8C9HAT1_BAD-02       --------------------------------------------------
A0A8C9GX27_BBC3-01      PARLGRSADRQVGGEWVGGIARPQSRPGTPRRGWHSRSPSQGQGQGRELG
A0A8C9HKG2_BIK-01       LLLLAL-----LLALLSGGLHLLLK-------------------------
A0A8C9HKG2_BIK-02       LVMSAQTSAWSWVSLWPESLHLADRILVSSPGQRPPEQPSWQPGPILHCP
A0A8C9LTX9_BMF-01       --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
                                                                          

A0A8C9H6M4_PMAIP1-      -------------------------------------
A0A8C9H6M4_PMAIP1-      -------------------------------------
A0A8C9HKG2_BIK-03       -------------------------------------
A0A8C9HAT1_BAD-01       -------------------------------------
A0A8C9HAT1_BAD-02       -------------------------------------
A0A8C9GX27_BBC3-01      CRGDQRRARSPRPRGLRASLGGAAHISRAIYSW----
A0A8C9HKG2_BIK-01       -------------------------------------
A0A8C9HKG2_BIK-02       PPGQLIALTCVHPLPVSHRLAAAGLFGHVLRATFPLS
A0A8C9LTX9_BMF-01       -------------------------------------
A0A8C9I5G9_BCL2L11      -------------------------------------
A0A8C9I5G9_BCL2L11      -------------------------------------
A0A8C9I5G9_BCL2L11      -------------------------------------
A0A8C9I5G9_BCL2L11      -------------------------------------
A0A8C9I5G9_BCL2L11      -------------------------------------
A0A8C9I5G9_BCL2L11      -------------------------------------
                                                             

© 1998-2022Legal notice