Dataset for protein classical BH3-containing proteins of organism Piliocolobus tephrosceles

[Download (right click)] [Edit] [Sequences] [Repertoires]

15 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9H6M4_PMAIP1-      --------------------------------------------------
A0A8C9H6M4_PMAIP1-      --------------------------------------------MPGKKA
A0A8C9HKG2_BIK-03       ------------MSGVRPISRDILMETLLYEQ----LLEPLTME------
A0A8C9HAT1_BAD-02       ------------MFQIPEFEPSEQEDSSSAER----GLGPSPVGDRPSDS
A0A8C9HAT1_BAD-01       ------------MFQIPEFEPSEQEDSSSAER----GLGPSPVGDRPSDS
A0A8C9GX27_BBC3-01      --------MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEP
A0A8C9HKG2_BIK-01       ----------------MPFRPQSRIPRSGCE-----RLLPGRGGEGPGRG
A0A8C9HKG2_BIK-02       ----------------MPFRPQSRIPRSGCE-----RLLPGRGGEGPGRG
A0A8C9LTX9_BMF-01       --MEPSRCVEELEDD--VFQPEDGEPGAQPGSSLSADLFAQSLLD-----
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A8C9I5G9_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                                                                          

A0A8C9H6M4_PMAIP1-      ----------------HRGSSHWTKAWSLALGPHSFPGTHRVYLVALRVR
A0A8C9H6M4_PMAIP1-      RKNAQPSPARAQAGAGTAGTARDQAGFGIGMQLHFTRGKNLLSSSPLALS
A0A8C9HKG2_BIK-03       ----------VLG---VTDPEEDLDPMED------FDPLEC---MEDSDM
A0A8C9HAT1_BAD-02       GKYHRQAPGLLWD---ASHQQEQPTSSSHHGGRAWYSPSES---EDSENP
A0A8C9HAT1_BAD-01       GKYHRQAPGLLWD---ASHQQEQPTSSSHHGG--------A---GAVETR
A0A8C9GX27_BBC3-01      GLAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDG
A0A8C9HKG2_BIK-01       GRGGAPGP--------IRSRAGSRAVDTKL--LRWLTDAAS--IAAASDM
A0A8C9HKG2_BIK-02       GRGGAPGP--------IRSRAGSRAVDTKL--LRWLTDAAS--IAAASDM
A0A8C9LTX9_BMF-01       -----------------------CPLSRLQLFPLTHCCGPGLRPTSQEDK
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A8C9I5G9_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                                                                          

A0A8C9H6M4_PMAIP1-      VVGPGTPARGSVGVQLASCR--RPT-------------------------
A0A8C9H6M4_PMAIP1-      SSPLALPRGHEEQVQVARSRVCYST-------------------------
A0A8C9HKG2_BIK-03       LALQLACIGDEMDVSLRAPRLAQLSEVAMHSLGLA----------FIYDQ
A0A8C9HAT1_BAD-02       SARMLAEASAGMSASATDSEAQHAENVKLEALGLWRPEVATAPTPRGRRR
A0A8C9HAT1_BAD-01       SRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLW----------AAQRY
A0A8C9GX27_BBC3-01      PQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVR----------GEEEQ
A0A8C9HKG2_BIK-01       LALQLACIGDEMDVSLRAPRLAQLSEVAMHSLGLA----------FIYDQ
A0A8C9HKG2_BIK-02       LALQLACIGDEMDVSLRAPRLAQLSEVAMHSLGLA----------FIYDQ
A0A8C9LTX9_BMF-01       ATQTLGPASPSQGVMLPCGVTEEPQRLFYG--------------------
A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSA--------------------
A0A8C9I5G9_BCL2L11      --------------------------------------------------
A0A8C9I5G9_BCL2L11      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSA--------------------
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSA--------------------
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSA--------------------
A0A8C9I5G9_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSA--------------------
                                                                          

A0A8C9H6M4_PMAIP1-      -RSSWRPRFPGSVAEWAAALAEMPGKKARKNAQPSP--------------
A0A8C9H6M4_PMAIP1-      -QEIWRQ-------------TEFPAETSESDSQTLL--------------
A0A8C9HKG2_BIK-03       -TDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRV--------------
A0A8C9HAT1_BAD-02       -TKGWRRSPAPF--GAARAP-------RPLTSGQHS--------------
A0A8C9HAT1_BAD-01       -GRELRRMSDEFVDSFKGLP-------RPKSAGTAT--------------
A0A8C9GX27_BBC3-01      WAREIGAQLRRMADDLNA------QYERRVSAGGGVDGRWDFPPEEGAAG
A0A8C9HKG2_BIK-01       -TDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRV--------------
A0A8C9HKG2_BIK-02       -TDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVRAFRFLTLTGSAAS
A0A8C9LTX9_BMF-01       -NAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQI--------------
A0A8C9I5G9_BCL2L11      -M-------------------------------VVI--------------
A0A8C9I5G9_BCL2L11      --ASRRQAEPADM-----------------RPEIRI--------------
A0A8C9I5G9_BCL2L11      -MASRRQAEPADM-----------------RPEIRI--------------
A0A8C9I5G9_BCL2L11      -MASRRQAEPADM-----------------RPEIRI--------------
A0A8C9I5G9_BCL2L11      -MASRRQAEPADM-----------------RPEIRI--------------
A0A8C9I5G9_BCL2L11      -MASRRQAEPADM-----------------RPEIRI--------------
                                                                          

A0A8C9H6M4_PMAIP1-      -----------------------------ARAQAELEVECATQLRRFGDK
A0A8C9H6M4_PMAIP1-      -----------------------------LRNLT----ESKTCIRGLQKR
A0A8C9HKG2_BIK-03       -----------------------------SREQVLLALLLLLAL-----L
A0A8C9HAT1_BAD-02       -----------------------------DMAASSGG-------------
A0A8C9HAT1_BAD-01       -----------------------------QMRQSSSWTRVFQSW-----W
A0A8C9GX27_BBC3-01      G----------------------------PRQMCCSCCPARLGRSADRQV
A0A8C9HKG2_BIK-01       -----------------------------SREQVLLALLLLLAL-----L
A0A8C9HKG2_BIK-02       GGCQSCSSGRHSPHHSLSSAVSSLSTSAWSHRLLSLGFLVMSAQTSAWSW
A0A8C9LTX9_BMF-01       -----------------------------ARKLQCIA----------DQF
A0A8C9I5G9_BCL2L11      -----------------------------LEDMGDTSLWFGFIFTGLDLY
A0A8C9I5G9_BCL2L11      -----------------------------AQELRRIG----------DEF
A0A8C9I5G9_BCL2L11      -----------------------------AQELRRIG----------DEF
A0A8C9I5G9_BCL2L11      -----------------------------AQELRRIG----------DEF
A0A8C9I5G9_BCL2L11      -----------------------------AQELRRIG----------DEF
A0A8C9I5G9_BCL2L11      -----------------------------AQELRRIG----------DEF
                                                                          

A0A8C9H6M4_PMAIP1-      LNFRQ-KLLNLIAKLFCSGT------------------------------
A0A8C9H6M4_PMAIP1-      IFLRRCTFHQFEARLHCNW-------------------------------
A0A8C9HKG2_BIK-03       LALLSGGLHLLLK-------------------------------------
A0A8C9HAT1_BAD-02       --------------------------------------------------
A0A8C9HAT1_BAD-01       DRNLGRGSSAPSQ-------------------------------------
A0A8C9GX27_BBC3-01      GGEWVGGIARPQSRPGTPRRGWHSRSPSQGQGQGRELGCRGDQRRARSPR
A0A8C9HKG2_BIK-01       LALLSGGLHLLLK-------------------------------------
A0A8C9HKG2_BIK-02       VSLWPESLHLADRILVSSPGQRPPEQPSWQPGPILHCPPPGQLIALTCVH
A0A8C9LTX9_BMF-01       HRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAGPRPLTWNGGRCQ
A0A8C9I5G9_BCL2L11      GHHHSQDTEQL---------------------NHRDFS------------
A0A8C9I5G9_BCL2L11      NAYYARRLAKL---------------------LASST-------------
A0A8C9I5G9_BCL2L11      NAYYARRVFLN---------------------NYQAAEDHPQMVILRLLR
A0A8C9I5G9_BCL2L11      NAYYARRVFLN---------------------NYQAAEDHPQMVILRLLR
A0A8C9I5G9_BCL2L11      NAYYARRMSLP---------------------PD----------------
A0A8C9I5G9_BCL2L11      NAYYARRLEK----------------------------------------
                                                                          

A0A8C9H6M4_PMAIP1-      -------------------------
A0A8C9H6M4_PMAIP1-      -------------------------
A0A8C9HKG2_BIK-03       -------------------------
A0A8C9HAT1_BAD-02       -------------------------
A0A8C9HAT1_BAD-01       -------------------------
A0A8C9GX27_BBC3-01      PRGLRASLGGAAHISRAIYSW----
A0A8C9HKG2_BIK-01       -------------------------
A0A8C9HKG2_BIK-02       PLPVSHRLAAAGLFGHVLRATFPLS
A0A8C9LTX9_BMF-01       TLLKGRLMSL---------------
A0A8C9I5G9_BCL2L11      -------------------------
A0A8C9I5G9_BCL2L11      -------------------------
A0A8C9I5G9_BCL2L11      YIVRLVWRMH---------------
A0A8C9I5G9_BCL2L11      YIVRLVWRMH---------------
A0A8C9I5G9_BCL2L11      -------------------------
A0A8C9I5G9_BCL2L11      -------------------------
                                                 

© 1998-2023Legal notice