Dataset for protein Puma of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|B2RVL4_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mus musculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|Q99ML1_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Mus musculus GN=BBC3 (length=128 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRV
>gnl|bcl2dbpro|Q99ML1_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Mus musculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|Q99ML1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mus musculus GN=BBC3 (length=91 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPD
© 1998-2022Legal notice