Dataset for protein Puma of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********                                                                     
HRSRPRGPRPDgpqpslspaqqhlespvpsapealaggptqaapgvrv--------------------------------
           -------------------------------------eeeewareigaqlrrmaddlnaqyerrrqeeq

       170       180       190   
....:....|....:....|....:....|...
                                 
---------------------------------
hrhrpspwrvmynlfmgllplprdpgapemepn
© 1998-2020Legal notice