Dataset for protein Puma of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q99ML1_BBC3-01      MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLC
Q99ML1_BBC3-03      MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLC
B2RVL4_BBC3-01      MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLC
Q99ML1_BBC3-02      MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLC
                    ************************************************************

Q99ML1_BBC3-01      APTAPPAVTAALGGPRWPGGHRSRPRGPRPD-----------------------------
Q99ML1_BBC3-03      APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
B2RVL4_BBC3-01      APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
Q99ML1_BBC3-02      APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
                    *******************************                             

Q99ML1_BBC3-01      ------------------------------------------------------------
Q99ML1_BBC3-03      QAAPGVRV----------------------------------------------------
B2RVL4_BBC3-01      QAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLP
Q99ML1_BBC3-02      QAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLP
                                                                                

Q99ML1_BBC3-01      -------------
Q99ML1_BBC3-03      -------------
B2RVL4_BBC3-01      LPRDPGAPEMEPN
Q99ML1_BBC3-02      LPRDPGAPEMEPN
                                 

© 1998-2020Legal notice