Dataset for protein Bad of organism Mus musculus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|Q61337_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mus musculus GN=BAD (length=204 residues).
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPG
LLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
SFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ
>gnl|bcl2dbpro|Q61337_BAD-05 BCL2-associated agonist of cell death protein OS=[Eukaryota] Mus musculus GN=BAD (length=131 residues).
MFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEG
MEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKVSASVRCDGT
© 1998-2020Legal notice