Dataset for protein Bad of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          **************************************
------------------------------------------MFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPG
mgtpkqpslapahalglrksdpgirslgsdaggrrwrpaaqs                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEG
                                                                                

       170       180       190       200    
....:....|....:....|....:....|....:....|....
***  .  .. **                               
SFKvspsvrsdGT-------------------------------
   glarpkca  atqmrqsagwtriiqswwdrnlgkggstpsq
© 1998-2020Legal notice