Dataset for protein Bad of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-01      MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
Q61337_BAD-05      ------------------------------------------MFQIPEFEPSEQEDASAT
                                                             ******************

Q61337_BAD-01      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-05      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
                   ************************************************************

Q61337_BAD-01      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
Q61337_BAD-05      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKVSASVRCDGT-------
                   *******************************************  .  .. **       

Q61337_BAD-01      AGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-05      ------------------------
                                           

© 1998-2020Legal notice