Dataset for protein Bad of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q61337_BAD-09      ------------------------------------------------------------
Q61337_BAD-07      -------------------------------------------XQIPEFEPSEQEDASAT
Q61337_BAD-05      ------------------------------------------MFQIPEFEPSEQEDASAT
Q61337_BAD-02      MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
Q61337_BAD-01      MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASAT
Q61337_BAD-04      ------------------------------------------MFQIPEFEPSEQEDASAT
Q61337_BAD-06      ------------------------------------------MFQIPEFEPSEQEDASAT
Q61337_BAD-03      ------------------------------------------MFQIPEFEPSEQEDASAT
                                                                               

Q61337_BAD-09      ------------------------------------------------------------
Q61337_BAD-07      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-05      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-02      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-01      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-04      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-06      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
Q61337_BAD-03      DRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
                                                                               

Q61337_BAD-09      ---------------------XAAQRYGRELRRMSDEFEGSFKFHLGSRHTHHPVSLTAQ
Q61337_BAD-07      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKSMLGLAVLIRPLSVSSD
Q61337_BAD-05      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKVSASVRCDGT-------
Q61337_BAD-02      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKG----------EELTYS
Q61337_BAD-01      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
Q61337_BAD-04      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
Q61337_BAD-06      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
Q61337_BAD-03      EGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
                                         *********************                 

Q61337_BAD-09      CR----ASWWWGPDSGCQNEAHSFLLLP
Q61337_BAD-07      LLGFPPSSSFVQDPVPSPGLCLHL----
Q61337_BAD-05      ----------------------------
Q61337_BAD-02      LSPFRCVQ--------------------
Q61337_BAD-01      AGWTRIIQSWWDRNLGKGGSTPSQ----
Q61337_BAD-04      AGWTRIIQSWWDRNLGKGGSTPSQ----
Q61337_BAD-06      AGWTRIIQSWWDRNLGKGGSTPSQ----
Q61337_BAD-03      AGWTRIIQSWWDRNLGKGGSTPSQ----
                                               

© 1998-2022Legal notice