Dataset for protein Bim of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=232 residues).
MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAR
TLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNH
YLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=292 residues).
MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAPGTLNPSPELCFLRCLRGDGQGAPGRRRARARRPGARARAR
TLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEI
RIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRLEK
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
SSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEATGSSLG
IALHREVQWPLEWLASS
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=85 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAEL
LASST
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=198 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
© 1998-2022Legal notice