Dataset for protein Bim of organism Macaca fascicularis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K5X1Y3_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Macaca fascicularis GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFN
AYYARRMSLPPD
© 1998-2020Legal notice