Dataset for protein Bim of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
tlrsegkartkkdq                                         gnpegnhggegdscphgspqgplap

       170       180       190       200       210       220       230       240
                                        . ..*     . :*      : ** * :           .
paspgpfatrsplfifmrrssllsrsssgyfsfdtasrrqaepa mrpeiria elrrigde  a yarr---leeltgs
                                                                          a ag  

       250       260       270       280       290       
 twigl ftg dly hh-sqvtwq-nw-pss                          
  gfaf            redqep ms dpd                          
                         lh af                           
© 1998-2022Legal notice