Dataset for protein Bim of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaarargaacgtlgcpaecggglagrrglcaapgtlnpspelcflrclrgdgqgapgrrrararrpgararar
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *****************************************                         
--------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ-------------------------
tlrsegkartkkdq                                         gnpegnhggegdscphgspqgplap
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        . ..*     . :*      : ** * :           .
-----------------------------------drspapmscD-----kstQtpsppcqaFNhYlsamasrrqaepad
paspgpfatrsplfifmrrssllsrsssgyfsfdtasrrqaepa mrpeiria elrrigde  a yarr---leeltgs
                                                                      vvi-ddild 
                                                                          a ag  
                                                                                
                                                                                

       250       260       270       280       290       
....:....|....:....|....:....|....:....|....:....|....:..
                                                         
mrpeiriaqelrrigdefnayyarrvflnny--------------------------
sl---------------h------l--k---qaaedhpqmvilrllryivrlvwrmh
 twigl ftg dly hh-sqvtwq-nw-pss                          
  gfaf            redqep ms dpd                          
                         lh af                           
                         ee                              
© 1998-2021Legal notice