Dataset for protein Bim of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5X1Y3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5X1Y3_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
                        **************************************************

A0A2K5X1Y3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5X1Y3_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
                        **************************************************

A0A2K5X1Y3_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE---------------
A0A2K5X1Y3_BCL2L11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQ
                        *******************************.                  

A0A2K5X1Y3_BCL2L11      ----------------------
A0A2K5X1Y3_BCL2L11      ELRRIGDEFNAYYARRMSLPPD
                                              

© 1998-2020Legal notice