Dataset for protein Bim of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A2K5X1Y3_BCL2L11      MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
A0A2K5X1Y3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
                                                                    ******

A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
                        ***********************************               

A0A2K5X1Y3_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X1Y3_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X1Y3_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X1Y3_BCL2L11      ---------------------------------------------DRSPA
A0A2K5X1Y3_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2K5X1Y3_BCL2L11      ---------------------------------------------ASRRQ
A0A2K5X1Y3_BCL2L11      ---------------------------------------------DRSPA
A0A2K5X1Y3_BCL2L11      ---------------------------------------------DRSPA
                                                                          

A0A2K5X1Y3_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQE
A0A2K5X1Y3_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQE
A0A2K5X1Y3_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQE
A0A2K5X1Y3_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQE
A0A2K5X1Y3_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQE
A0A2K5X1Y3_BCL2L11      AEPADMRPEIRIAQELRRIGDEFNAYYARR---LAELLASST--------
A0A2K5X1Y3_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAMVVILEDIGDSSLWFGFIFTG
A0A2K5X1Y3_BCL2L11      PMSCD-----KSTQTPSPPCQAFNHYLSAM----DEATGSSLGIAL----
                        . ..*     . :*      : ** * :           .          

A0A2K5X1Y3_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5X1Y3_BCL2L11      LRRIGDEFNAYYARRLEK-----------------------------
A0A2K5X1Y3_BCL2L11      LRRIGDEFNAYYARRMSLPPD--------------------------
A0A2K5X1Y3_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5X1Y3_BCL2L11      LRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH
A0A2K5X1Y3_BCL2L11      -----------------------------------------------
A0A2K5X1Y3_BCL2L11      LDLYGHHHSQDTEQLNHKDFS--------------------------
A0A2K5X1Y3_BCL2L11      -------HREVQWPLEWLASS--------------------------
                                                                       

© 1998-2022Legal notice