Dataset for protein Bim of organism Homo sapiens

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q6JTU4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Homo sapiens GN=BCL2L11 (length=36 residues).
MRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice