Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      ---------------MRQAEPADMRPEI----------------------
O43521_BCL2L11-04      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-05      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-10      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-19      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-01      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-06      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-18      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-08      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-21      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-12      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
O43521_BCL2L11-20      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-07      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-22      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-02      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-15      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-09      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-14      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-17      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-03      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-23      --KQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-13      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
O43521_BCL2L11-16      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                                       ** :**:  *::                      

Q6JTU4_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-05      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-10      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-19      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-01      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-06      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-18      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-08      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-21      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-12      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-09      --------------------------------------------------
O43521_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-04      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-05      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-10      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-11      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-19      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-01      TDRSPAPMSCDKSTQTPSPPCQ----------------------------
O43521_BCL2L11-06      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV-----
O43521_BCL2L11-18      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----VREIEEVVV-----
O43521_BCL2L11-08      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ANWD----------
O43521_BCL2L11-21      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ANWD----------
O43521_BCL2L11-12      TDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----GIFE----------
O43521_BCL2L11-20      ------------------------------------ASMRQAEPADMR-P
O43521_BCL2L11-07      ------------------------------------ASMRQAEPADMR-P
O43521_BCL2L11-22      ------------------------------------ASMRQAEPADMR-P
O43521_BCL2L11-02      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------VVILEDIGDLSLC
O43521_BCL2L11-15      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------VVILEDIGDLSLC
O43521_BCL2L11-09      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-14      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM-----ASMRQAEPADMR-P
O43521_BCL2L11-17      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV----------
O43521_BCL2L11-03      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWP
O43521_BCL2L11-23      -DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWP
O43521_BCL2L11-13      -GNPEGNHGGEGDSCPHG--------------SPQGPLAPPASPG-----
O43521_BCL2L11-16      -VS----------LCHPGWSALVRSWLTATSNSQVQAVLLPQPPK-----
                                                                         

Q6JTU4_BCL2L11-01      --WIAQELRRIGDEFNAYYARRLEK-------------------------
O43521_BCL2L11-04      EIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLV
O43521_BCL2L11-05      EIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLV
O43521_BCL2L11-10      EIWIAQELRRIGDEFNAYYARRLEK-------------------------
O43521_BCL2L11-11      EIWIAQELRRIGDEFNAYYARRMPLPPD----------------------
O43521_BCL2L11-19      EIWIAQELRRIGDEFNAYYARRMPLPPD----------------------
O43521_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-20      EIWIAQELRRIGDEFNAYYARRMPLPPD----------------------
O43521_BCL2L11-07      EIWIAQELRRIGDEFNAYYARRLAKLLASST-------------------
O43521_BCL2L11-22      EIWIAQELRRIGDEFNAYYARRLAKLLASST-------------------
O43521_BCL2L11-02      FGFIFTGLDLYGHHHSQDTEQLNHKDFS----------------------
O43521_BCL2L11-15      FGFIFTGLDLYGHHHSQDTEQLNHKDFS----------------------
O43521_BCL2L11-09      EIWIAQELRRIGDEFNAYYARRLEK-------------------------
O43521_BCL2L11-14      EIWIAQELRRIGDEFNAYYARRLEK-------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-03      LKWLAKSS------------------------------------------
O43521_BCL2L11-23      LKWLAKSS------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
                                                                         

Q6JTU4_BCL2L11-01      ----
O43521_BCL2L11-04      WRMH
O43521_BCL2L11-05      WRMH
O43521_BCL2L11-10      ----
O43521_BCL2L11-11      ----
O43521_BCL2L11-19      ----
O43521_BCL2L11-01      ----
O43521_BCL2L11-06      ----
O43521_BCL2L11-18      ----
O43521_BCL2L11-08      ----
O43521_BCL2L11-21      ----
O43521_BCL2L11-12      ----
O43521_BCL2L11-20      ----
O43521_BCL2L11-07      ----
O43521_BCL2L11-22      ----
O43521_BCL2L11-02      ----
O43521_BCL2L11-15      ----
O43521_BCL2L11-09      ----
O43521_BCL2L11-14      ----
O43521_BCL2L11-17      ----
O43521_BCL2L11-03      ----
O43521_BCL2L11-23      ----
O43521_BCL2L11-13      ----
O43521_BCL2L11-16      ----
                           

© 1998-2022Legal notice