Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O43521_BCL2L11-20      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVSLCHPGWS
Q6JTU4_BCL2L11-01      ---------------MRQAEPADMRPEI----------------------
                                       ** :**:  *::                      

O43521_BCL2L11-20      ALVRSWLTAT---SNSQVQAVLLPQPPK
Q6JTU4_BCL2L11-01      -----WIAQELRRIGDEFNAYYARRLEK
                            *::      ..:.:*    .  *

© 1998-2020Legal notice