Dataset for protein Bim of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                ** :**:  *::                                                    
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------------------------------
---------------m  ae  dmr ei-------------gnpegnhggegdscphgspqgplappaspgpfatrsplf
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------drspapmscdkstqtpsppcqafnhylsam-----asmrqaepad---p--wiaqel--
ifmrrssllsrsssgyfsfdt------------------------------dssag-vvi------mrw-ei------rr
                     vspegnhggegdscphgwsalvrswltatsvdqvqv-l-pevvgevslclkflftssdl
                     gn          l h               nrpqesr-dlqliv lq  fg   kg   
                                                     ei pnwvi dhr               
                                                        glepe s k               
                                                        eifl  p                 
                                                          ae                    

       170       180       190       200    
....:....|....:....|....:....|....:....|....
                                            
-g------------------------------------------
i-defnayyarrlekppdsstedhprmvilrllryivrlvwrmh
y hhhsqdteqlmplnnyqaa                       
            vh lls                          
            nf dfa                          
             a                              
                                            
                                            
© 1998-2022Legal notice