Dataset for protein classical BH3-containing proteins of organism Gopherus evgoodei

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C4VJX6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL2L11 (length=202 residues).
MKQTRRDRGLARGGSWAWWRWRVGALRSAWINSPALRRGWLCPRWGGFHRHVALGRRQEKDQMAKQPSDLNSECDREGGQ
FQSTERPSQPQHLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSIREDMQPEIWIAQELR
RIGDEFNASYCPRRGFLDNPAVNHQIVLRLLRYIIRLIWRLQ
>gnl|bcl2dbpro|A0A8C4VJX6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Gopherus evgoodei GN=BCL2L11 (length=172 residues).
MKQTRRDRGLARGGSWAWWRWRVGALRSAWINSPALRRGWLCPRWGGFHRHVALGRRQEKDQMAKQPSDLNSECDREGGQ
FQSTERPSQPQHLRPGAPTSIQTQYQASRWESPSIREDMQPEIWIAQELRRIGDEFNASYCPRRGFLDNPAVNHQIVLRL
LRYIIRLIWRLQ
>gnl|bcl2dbpro|A0A8C4W1J6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Gopherus evgoodei GN=BMF (length=192 residues).
MDPPNYLEDDYSSLDGLDDDVFHSDFGLTGQPGEMTPPGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTL
SPSSSTQDVMLPCGVTEEPQRLFYGNAGYRLHVPPVGFALNPHLQEEPREGQREALAEVQIARKLQCIADQFHRLHIQRH
QQNRNQVWWQILLFIHNLALNVEVNRNHVGQR
>gnl|bcl2dbpro|A0A8C4WLZ6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Gopherus evgoodei GN=BAD (length=141 residues).
MFRIQEFPDEVFPGRGKEAPAPPESQRGHTPGSKQPDTPTAEVRSRIGSDTPSLEPEVQDEPGGAFRARSRSAPPILWAA
MRYGRELRRMSDEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAWLGHRPTRDALPRSSK
>gnl|bcl2dbpro|A0A8C4WNF3_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gopherus evgoodei GN=PMAIP1 (length=46 residues).
MTGFPLCFTAQEAVTQCSLQLRKIGDICNLQQKILNVITKLFCPGT
© 1998-2022Legal notice