Dataset for protein classical BH3-containing proteins of organism Gopherus evgoodei

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4WNF3_PMAIP1-      --------------------------------------------------
A0A8C4WLZ6_BAD-01       --------------------------------------------------
A0A8C4W1J6_BMF-01       MDPPNYLEDDYSSLDGLDDDVFHSDFGLTG---------QPGEMTPPGIF
A0A8C4VJX6_BCL2L11      ------------------MKQTRRDRGLARGGSWAWWRWRVGALRSAWIN
A0A8C4VJX6_BCL2L11      ------------------MKQTRRDRGLARGGSWAWWRWRVGALRSAWIN
                                                                          

A0A8C4WNF3_PMAIP1-      ------------MTGFPLCFTAQEAVTQCS--------------------
A0A8C4WLZ6_BAD-01       ---------MFRIQEFPDEVFPGRGKEAP----------APPESQRGHTP
A0A8C4W1J6_BMF-01       TQNQSYSCLLGRFQLFPLTHCCGPGIRHAEQQDKATQTLSPSSSTQDVML
A0A8C4VJX6_BCL2L11      SPALRRGWLCPRWGGFHRHVALGRRQEKDQMAKQPSDLNSECDREGGQFQ
A0A8C4VJX6_BCL2L11      SPALRRGWLCPRWGGFHRHVALGRRQEKDQMAKQPSDLNSECDREGGQFQ
                                       *                                  

A0A8C4WNF3_PMAIP1-      --------------------------------------------------
A0A8C4WLZ6_BAD-01       GSKQPDTPTAEVRS------------------------------------
A0A8C4W1J6_BMF-01       PCGVTEEPQRLFYGNA----------------------------------
A0A8C4VJX6_BCL2L11      STERPSQPQHLRPGAPTSIQTQYQDRSPAPMSCDKSTQTPSPPCQAFNHY
A0A8C4VJX6_BCL2L11      STERPSQPQHLRPGAPTSIQTQYQ--------------------------
                                                                          

A0A8C4WNF3_PMAIP1-      -------------------------------------------LQLRKIG
A0A8C4WLZ6_BAD-01       ----RIGSDTPSLEPEVQDEPGGAFRARSRSAPPILWAAMRYGRELRRMS
A0A8C4W1J6_BMF-01       ----GYRLHVPPVGFALNPHLQEEPREGQREALAEVQIA----RKLQCIA
A0A8C4VJX6_BCL2L11      LSAMASRWESPSIREDMQP---------------EIWIA----QELRRIG
A0A8C4VJX6_BCL2L11      ----ASRWESPSIREDMQP---------------EIWIA----QELRRIG
                                                                    :*. :.

A0A8C4WNF3_PMAIP1-      DICNLQQ----------------------KILNVITKLFCPGT-------
A0A8C4WLZ6_BAD-01       DEFDVALQVLPRPKSAGTTSQLHRGNSWKETLQAW--LGHRPTRDALPRS
A0A8C4W1J6_BMF-01       DQFHRLH----IQR-----HQQNRNQVWWQILLFIHNLALNVEVNRNHVG
A0A8C4VJX6_BCL2L11      DEFNASY----CPRRGFLDNPAVNHQIVLRLLRYIIRLIWRLQ-------
A0A8C4VJX6_BCL2L11      DEFNASY----CPRRGFLDNPAVNHQIVLRLLRYIIRLIWRLQ-------
                        *                              *     *            

A0A8C4WNF3_PMAIP1-      --
A0A8C4WLZ6_BAD-01       SK
A0A8C4W1J6_BMF-01       QR
A0A8C4VJX6_BCL2L11      --
A0A8C4VJX6_BCL2L11      --
                          

© 1998-2022Legal notice