Dataset for protein Bim of organism Coturnix japonica

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C2TW35_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Coturnix japonica GN=BCL2L11 (length=152 residues).
MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAARPASPGSPGPFAIRSPLFFFVRRSPLLQRSSSGYFSF
EAERSPAPMSCDKATQTPSPPCQAVSHYLSAMGEELGNSASIHLDKEVEQAGVAAVLSCLQASSMHCGCMVS
>gnl|bcl2dbpro|A0A8C2TYI5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Coturnix japonica GN=BCL2L11 (length=88 residues).
MGPGGERRREEEEKRRRRKGRAGPAPAAQRSAPPAEIQPEIWIAQELRRIGDEFNASYCPRRVIFSYFYFPFLYARSLKG
KSLIISGN
© 1998-2022Legal notice