Dataset for protein Bim of organism Coturnix japonica

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2TW35_BCL2L11      ------MAKQPPEAKAPRDRRAGRLPPGEGPGPAVPLRPGAPAALPGAAR
A0A8C2TYI5_BCL2L11      MGPGGERRREEEEKRRRRKGRAGPAPAAQRSAPPAEIQP--EIWIAQELR
                                .:  * .  *. ***  *..: ..*.. :.*     :.   *

A0A8C2TW35_BCL2L11      PASPGSPGPFAIRSPLFFFVRRSPLLQRSSSGYFSFEAERSPAPMSCDKA
A0A8C2TYI5_BCL2L11      RIGDEFNASYCPRRVIFSYF------------YFPF--------------
                          .    ..:. *  :* :.            **.*              

A0A8C2TW35_BCL2L11      TQTPSPPCQAVSHYLSAMGEELGNSASIHLDKEVEQAGVAAVLSCLQASS
A0A8C2TYI5_BCL2L11      ---------------------------------------------LYARS
                                                                     * * *

A0A8C2TW35_BCL2L11      MHCGCMVS---
A0A8C2TYI5_BCL2L11      LKGKSLIISGN
                        ::  .::    

© 1998-2022Legal notice