Dataset for protein Bim of organism Coturnix japonica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .:  * .  *. ***  *..: ..*.. :.*     :.   *  .    ..:. *  :* :.          
------rrrqppEkrrrRkrRAGrlPpgqrsgPpvplrP--piwlpqelRrispgspgsycpRsvlFsyv----------
mgpggemakeee akap dg   pa aaegpa aaeiq gaeaaiagaa pagdefnapfai rpi fffrrspllqrss

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  **.*                                                           * * *::  .::   
--YFsF-----------------------------------------------------------LyAsSmkgksmvs--
sg  p eaerspapmscdkatqtpsppcqavshylsamgeelgnsasihldkeveqagvaavlsc q r lhcgcliisg

 
.
 
-
n
© 1998-2022Legal notice