Dataset for protein Bmf of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A7N5JI49_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BMF (length=261 residues).
MPRAGVFWKQYRAVHSGLLPRQPASCRRRPCPCLPPPATRRGPWAPSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEP
PQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVM
LPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQV
LLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A7N5JI49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BMF (length=233 residues).
MFPREAGLFPSFPIEWAPSPRVLVTLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLS
ADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFP
AGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQVLLFLHNLALNADENRNGAGPR
>gnl|bcl2dbpro|A0A7N5JI49_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BMF (length=197 residues).
MRAWWLLLRAVREMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQED
KATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRL
HMQQHQQNQNRVWWQVLLFLHNLALNADENRNGAGPR
© 1998-2022Legal notice