Dataset for protein Bmf of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N5JI49_BMF-03      ----------------------------------------MRAWW-----
A0A7N5JI49_BMF-02      -MPRAGVFWKQYRAVHSGLLPRQPASCRRRPCPCLPPPATRRGPWAPSPR
A0A7N5JI49_BMF-01      MFPR-----------EAGLFPSFPIE------------------WAPSPR
                                                                   *     

A0A7N5JI49_BMF-03      --------------------LLLRAVREMEPPQCVEELEDDVFQPEDGEP
A0A7N5JI49_BMF-02      VLVTLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEP
A0A7N5JI49_BMF-01      VLVTLDPGAEPWHHDSEAETLSWSHPGEMEPPQCVEELEDDVFQPEDGEP
                                           *      ***********************

A0A7N5JI49_BMF-03      GTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQT
A0A7N5JI49_BMF-02      GTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQT
A0A7N5JI49_BMF-01      GTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQT
                       **************************************************

A0A7N5JI49_BMF-03      LSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPE
A0A7N5JI49_BMF-02      LSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPE
A0A7N5JI49_BMF-01      LSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPE
                       **************************************************

A0A7N5JI49_BMF-03      GPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQVLLFLHNLAL
A0A7N5JI49_BMF-02      GPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQVLLFLHNLAL
A0A7N5JI49_BMF-01      GPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQVLLFLHNLAL
                       **************************************************

A0A7N5JI49_BMF-03      NADENRNGAGPR
A0A7N5JI49_BMF-02      NADENRNGAGPR
A0A7N5JI49_BMF-01      NADENRNGAGPR
                       ************

© 1998-2022Legal notice