Dataset for protein Bmf of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            *                         *      ***
--pr-------------gl-p--p-----------------r--WapsprvlvtldpgaepwhhdseaetLswshpgEME
mm--agvfwkqyravhs--l-sq-iscrrrpcpclpppatr-gw ------------------------- llravr   
 f             ea  f rf ae              m ap                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGV
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGPWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQ
                                                                                
                                                                                

       250       260  
....:....|....:....|..
**********************
VLLFLHNLALNADENRNGAGPR
                      
                      
© 1998-2022Legal notice