Dataset for protein Bcl-xL of organism Vombatus ursinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X2JXQ8_BCL2L1-      MSHGNRELVVDFLSYKLSQKGYSWSQFEDENRTEAPEGTEIPSTVNGSPS
A0A4X2KZ04_BCL2L1-      ------------------------------PQTPAPEGTET-STVNGSPS
                                                       .* ******  ********

A0A4X2JXQ8_BCL2L1-      WHPADSHAVSGATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFS
A0A4X2KZ04_BCL2L1-      WHPADNHAVSGATGHSSSLDAHETIPVAAVKQALKEAGDEFELWYRWAFS
                        *****.****************************.********.**.***

A0A4X2JXQ8_BCL2L1-      DLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVD
A0A4X2KZ04_BCL2L1-      DLTSH-----------FEQVVNELFRDRVNWGRIVAFFSFGGALCVERVD
                        ****:           *********** ******************* **

A0A4X2JXQ8_BCL2L1-      KEMEVLVGRITSWMATYLDDHLDPWIQENGGWDTFVELYGNDAAAESRKG
A0A4X2KZ04_BCL2L1-      KEMEVLVGRITSWMATYLDDHLDPWISENGGWDTFAEPYENNAAAESREG
                        **************************.********.* * *:******:*

A0A4X2JXQ8_BCL2L1-      QERFNRWLLTGMTVAGVVLLGSLFSRK
A0A4X2KZ04_BCL2L1-      QESFIRWLLTGMTVAGVVLLGSLFSRK
                        ** * **********************

© 1998-2020Legal notice