Dataset for protein Bcl-xL of organism Vombatus ursinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                               .* ******  *************.************************
mshgnrelvvdflsyklsqkgyswsqfedenq e      ip             n                        

        90       100       110       120       130       140       150       160
****.********.**.*******:           *********** ******************* ************
    k        r  r       hlhitpgtayqs           g                   r            

       170       180       190       200       210       220       
****************.********.* * *:******:*** * **********************
                q        a l e d      e   r i                      
© 1998-2021Legal notice