Dataset for protein Bcl-xL of organism Vombatus ursinus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4X2JXQ8_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L1 (length=227 residues).
MSHGNRELVVDFLSYKLSQKGYSWSQFEDENRTEAPEGTEIPSTVNGSPSWHPADSHAVSGATGHSSSLDAHETIPVAAV
KQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVGRI
TSWMATYLDDHLDPWIQENGGWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A4X2KZ04_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Vombatus ursinus GN=BCL2L1 (length=185 residues).
PQTPAPEGTETSTVNGSPSWHPADNHAVSGATGHSSSLDAHETIPVAAVKQALKEAGDEFELWYRWAFSDLTSHFEQVVN
ELFRDRVNWGRIVAFFSFGGALCVERVDKEMEVLVGRITSWMATYLDDHLDPWISENGGWDTFAEPYENNAAAESREGQE
SFIRWLLTGMTVAGVVLLGSLFSRK
© 1998-2020Legal notice