Dataset for protein Mcl-1 of organism Sarcophilus harrisii

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7N4PRP1_MCL1-01      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4PRP1_MCL1-02      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
A0A7N4PRP1_MCL1-03      MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSP
                        **************************************************

A0A7N4PRP1_MCL1-01      PRLDGGEVGASTTTTAAAAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4PRP1_MCL1-02      PRLDGGEVGAS------AAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
A0A7N4PRP1_MCL1-03      PRLDGGEVGASTTTTAAAAVGLRGGSGGANPPDPVVPGVRGVARPAPIGA
                        ***********      *********************************

A0A7N4PRP1_MCL1-01      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4PRP1_MCL1-02      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
A0A7N4PRP1_MCL1-03      EARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPG
                        **************************************************

A0A7N4PRP1_MCL1-01      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4PRP1_MCL1-02      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
A0A7N4PRP1_MCL1-03      KRPARLAMLPLAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLE
                        **************************************************

A0A7N4PRP1_MCL1-01      LITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHETAFQGMLRKL
A0A7N4PRP1_MCL1-02      LITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHETAFQGMLRKL
A0A7N4PRP1_MCL1-03      LITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHETAFQGMLRKL
                        **************************************************

A0A7N4PRP1_MCL1-01      DIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQES
A0A7N4PRP1_MCL1-02      DIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQES
A0A7N4PRP1_MCL1-03      DIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQES
                        **************************************************

A0A7N4PRP1_MCL1-01      CIDPLAESITDVLVKSKRDWLMKQKGWEMPLCDLRWSLQPSPSPVMNLLV
A0A7N4PRP1_MCL1-02      CIDPLAESITDVLVKSKRDWLMKQKGWE-GFVEF-FHVEDLEGGIRNVLL
A0A7N4PRP1_MCL1-03      CIDPLAESITDVLVKSKRDWLMKQKGWE-GFVEF-FHVEDLEGGIRNVLL
                        ****************************  : :: : ::   . : *:*:

A0A7N4PRP1_MCL1-01      SEYSKGSGLGVLCEQGWQYLVLVPFWLALLKVF
A0A7N4PRP1_MCL1-02      A-FAGVAGVGA----GLAYLIR-----------
A0A7N4PRP1_MCL1-03      A-FAGVAGVGA----GLAYLIR-----------
                        : ::  :*:*.    *  **:            

© 1998-2021Legal notice