Dataset for protein Mcl-1 of organism Sarcophilus harrisii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************************************      *************
MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSPPRLDGGEVGASttttaaAAVGLRGGSGGAN
                                                             ------             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PPDPVVPGVRGVARPAPIGAEARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLP
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHE
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
TAFQGMLRKLDIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDW
                                                                                

       330       340       350       360       370       380   
....:....|....:....|....:....|....:....|....:....|....:....|...
********  : :: : ::   . : *:*:: ::  :*:*.    *  **:            
LMKQKGWE-gfvef-fhvedleggirNvLla-fagvaGvGa----GlaYLir-----------
        mplcdlrwslqpspspvm l vseyskgs l vlceq wq  vlvpfwlallkvf
© 1998-2021Legal notice