Dataset for protein Mcl-1 of organism Sarcophilus harrisii

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A7N4PRP1_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=MCL-1 (length=359 residues).
MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSPPRLDGGEVGASAAVGLRGGSGGANPPDPVV
PGVRGVARPAPIGAEARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLPLAREGG
DTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHETAFQGM
LRKLDIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDWLMKQKG
WEGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A7N4PRP1_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=MCL-1 (length=365 residues).
MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSPPRLDGGEVGASTTTTAAAAVGLRGGSGGAN
PPDPVVPGVRGVARPAPIGAEARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLP
LAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDW
LMKQKGWEGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A7N4PRP1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Sarcophilus harrisii GN=MCL-1 (length=383 residues).
MLGPFKKNAVIGLNLYCGGAGLGAGSGASASPSGGRLLTNGKGTAVESSPPRLDGGEVGASTTTTAAAAVGLRGGSGGAN
PPDPVVPGVRGVARPAPIGAEARDVTAPPRPFFFAPGGRCSPPAEVADGAADAILSPEDELDGYEPELPGKRPARLAMLP
LAREGGDTSSNARGSLPSTPPPAEEDEDEEEDELYGQSLELITRYLREQAVGTKDTKPLRSGKALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEEDIKAVSRVVTHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIDPLAESITDVLVKSKRDW
LMKQKGWEMPLCDLRWSLQPSPSPVMNLLVSEYSKGSGLGVLCEQGWQYLVLVPFWLALLKVF
© 1998-2021Legal notice