Dataset for protein BCL-2-like of organism Podarcis muralis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670IB81_BCL2-01      --------------------------------------------------
A0A670IBZ4_BCL2L1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670K3Y6_MCL1-01      MFNKKSVVLYCGGAPSMAPATPVSPGAGGGGSSSGAPTASAAAAAVFTAN
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
                                                                          

A0A670IB81_BCL2-01      ---------------------------MMAQTGIRGYDTREIVQTYIHYK
A0A670IBZ4_BCL2L1-      ----------------------------------MSRNNRALVVDFVSYK
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670K3Y6_MCL1-01      GRSEGAGPFSPRIGRGWGASVFPEGPLPRIGSGAPLAGPLARIGPFEVAP
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
                                                                          

A0A670IB81_BCL2-01      LSQKGYDWVASED--------REDLPSPPLPPDPPAAETFPNLARLASHP
A0A670IBZ4_BCL2L1-      LSERGHSWDELEEDSENRTELRDEMDSVPNGSPSWHQSTSPVVNGATGHP
A0A670JXJ0_BCL2A1-      ---------------------MKRLKSLSSALKQPANHLNLHCGGHSLHF
A0A670K3Y6_MCL1-01      RALIGSPAAAAVGGGAARPLALALPEGELDGCDDEAEAQAAQAGDLPSPT
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      ---------------------MKRLKSLSSALKQPANHLNLHCGGHSLHF
                                                                          

A0A670IB81_BCL2-01      SELPVSN-------------------VAPAGGPHPVPQVVHATLRQAGDE
A0A670IBZ4_BCL2L1-      SILSDLE-------------------DSPRLD-------VRQTLREAGDE
A0A670JXJ0_BCL2A1-      ALCAHFSMENNQLQSVDTLVQDYLKHVCEDAELDAAPSRVAQVLARVAPS
A0A670K3Y6_MCL1-01      PSLESIPSAQGDDDDAAVTLELVSRYLREEAAASPGAAQALETLRRVGDN
A0A670JXJ0_BCL2A1-      --------------------------MESRGEGAAVSAGDMAALHAAKGA
A0A670JXJ0_BCL2A1-      ALCAHFSMENNQLQSVDTLVQDYLKHVCEDAELDAAPSRVAQVLARVAPS
                                                                  .*  .   

A0A670IB81_BCL2-01      FSRRYRRDFAQMSGQLHLTPVTARARF-AAVVEELFRDG-VNWGRIVAFF
A0A670IBZ4_BCL2L1-      FELRYRRAFSDLTSQLHITPGTAYQSF-EQVVNELFRDG-VNWGRIVAFF
A0A670JXJ0_BCL2A1-      LQEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILTIF
A0A670K3Y6_MCL1-01      ILDKHQLAFQGMLRKIEIKKEDDLKTV-SEVAKHLFSDGITNWGRIVTLI
A0A670JXJ0_BCL2A1-      LRAELKRRLGAL--------------------------------------
A0A670JXJ0_BCL2A1-      LQEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILTIF
                        :       :  :                                      

A0A670IB81_BCL2-01      EFGGMMCVESVSREMS----------------------------------
A0A670IBZ4_BCL2L1-      SFGGALCVESVDKEMR----------------------------------
A0A670JXJ0_BCL2A1-      VFAGIIAKKLRQHGVPLTRENVEPICHCVTEFINTKATWISENGGW----
A0A670K3Y6_MCL1-01      SFGAFVAKHLKRINQE----------------------------------
A0A670JXJ0_BCL2A1-      ----SAAEKLRQSRLV---------------------------RGKVLEH
A0A670JXJ0_BCL2A1-      VFAGIIAKKLRQHGVPLTRENVEPICHCVTEFINTKATWISENGGWVLEH
                              .                                           

A0A670IB81_BCL2-01      ---------------PLVDNITVWMTDYLNGHLDNWIQDNGGWDAFVELY
A0A670IBZ4_BCL2L1-      ---------------VLVGRIVSWMTTYLTDHLDPWIQENGGWERFVDLY
A0A670JXJ0_BCL2A1-      ----------------------DSFLAKLGEEKSPWLALHYIKTKLISAF
A0A670K3Y6_MCL1-01      ---------------SAIGRLAELITEVLVTDKREWILNNNAWEGFVNFF
A0A670JXJ0_BCL2A1-      PKYQASQRIAVFLSMSDEVQTEEIIKDIFQHGKECFIPHYKPRSSHMDMV
A0A670JXJ0_BCL2A1-      PKYQASQRIAVFLSMSDEVQTEEIIKDIFQHGKECFIPHYKPRSSHMDMV
                                                :   :      ::     .   :.  

A0A670IB81_BCL2-01      SN------------------------------------------------
A0A670IBZ4_BCL2L1-      GN------------------------------------------------
A0A670JXJ0_BCL2A1-      SF------------------------------------------------
A0A670K3Y6_MCL1-01      HV-----------------EDVEGSIRSVLMAFAG------VAGIG----
A0A670JXJ0_BCL2A1-      KLASYEEIALLPLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFDQT
A0A670JXJ0_BCL2A1-      KLASYEEIALLPLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFDQT
                                                                          

A0A670IB81_BCL2-01      ---------------NMRP--------LFDFSWLPLKTILSLAVVGACIT
A0A670IBZ4_BCL2L1-      ---------------DAAAKSRKGQERFNKWLW-------TGATVAGVVL
A0A670JXJ0_BCL2A1-      ----------FSQYY-----------------------------------
A0A670K3Y6_MCL1-01      ----------------------AGLAYMIR--------------------
A0A670JXJ0_BCL2A1-      GNRLGRGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVVPASENDVKV
A0A670JXJ0_BCL2A1-      GNRLGRGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVVPASENDVKV
                                                                          

A0A670IB81_BCL2-01      LGAYLGHK
A0A670IBZ4_BCL2L1-      LGSLLSRK
A0A670JXJ0_BCL2A1-      --------
A0A670K3Y6_MCL1-01      --------
A0A670JXJ0_BCL2A1-      DEILFEDN
A0A670JXJ0_BCL2A1-      DEILFEDN
                                

© 1998-2020Legal notice