Dataset for protein BCL-2-like of organism Podarcis muralis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670JXJ0_BCL2A1-      --------MKRLKSL-----SSALKQPANHLNLHCGG-------------
A0A670K3Y6_MCL1-01      --------MFNKKSVVLYCGGAPSMAPATPVSPGAGGGGSSSGAPTASAA
A0A670IB81_BCL2-01      MMAQTGIRGYDTREIVQTYIHYKLSQKGYDWVASED--------------
A0A670IBZ4_BCL2L1-      -------MSRNNRALVVDFVSYKLSERGHSWDELEED-------------
A0A670JXJ0_BCL2A1-      -------------MKRLKSLSSALKQPANHLNLHCGG-------------
A0A670JXJ0_BCL2A1-      -----------------------MESRGEGAAVSAGD-------------
                                                   .                      

A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670K3Y6_MCL1-01      AAAVFTANGRSEGAGPFSPRIGRGWGASVFPEGPLPRIGSGAPLAGPLAR
A0A670IB81_BCL2-01      --------------------------------------------------
A0A670IBZ4_BCL2L1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
                                                                          

A0A670JXJ0_BCL2A1-      -------------------------HSLHFAL------------------
A0A670K3Y6_MCL1-01      IGPFEVAPRALIGSPAAAAVGGGAARPLALALPEGELDGCDDEAEAQAAQ
A0A670IB81_BCL2-01      ----------------------------REDL------------------
A0A670IBZ4_BCL2L1-      ---------------------SENRTELRDEM------------------
A0A670JXJ0_BCL2A1-      -------------------------HSLHFAL------------------
A0A670JXJ0_BCL2A1-      ---------------------MAALHAAKGAL------------------
                                                       :                  

A0A670JXJ0_BCL2A1-      CAHFSMENNQLQSVDT-------------LVQDYLKHVCEDAELDAAPSR
A0A670K3Y6_MCL1-01      AGDLPSPTPSLESIPSAQGDDDDAAVTLELVSRYLR---EEAAASPGAAQ
A0A670IB81_BCL2-01      PSPPLPPDPPAAETFP-------------NLARLASHPSELPVSNVAPAG
A0A670IBZ4_BCL2L1-      DSVPNGSPSWHQSTSP-------------VVNGATGHPSILSDLEDSPRL
A0A670JXJ0_BCL2A1-      CAHFSMENNQLQSVDT-------------LVQDYLKHVCEDAELDAAPSR
A0A670JXJ0_BCL2A1-      RAELKRRLGALSAAEK-------------LRQSRLVR----GKVLEHPKY
                         .                                             .  

A0A670JXJ0_BCL2A1-      VAQVLARVAPSLQEEV--EEKIKPLWHSIKISSVEEASDIFSQ----VMA
A0A670K3Y6_MCL1-01      ALETLRRVGDNILDKH--QLAFQGMLRKIEIKKEDDLKTV-SE----VAK
A0A670IB81_BCL2-01      GPHPVPQVVHATLRQAGDEFSRRYRRDFAQMSGQLHLTPVTARARFAAVV
A0A670IBZ4_BCL2L1-      D-------VRQTLREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
A0A670JXJ0_BCL2A1-      VAQVLARVAPSLQEEV--EEKIKPLWHSIKISSVEEASDIFSQ----VMA
A0A670JXJ0_BCL2A1-      QASQRIAVFLSMSDEVQTEEIIKDIFQHGKECFIPHYKPRSSH----MDM
                                      :   :   .      .       .   :        

A0A670JXJ0_BCL2A1-      QEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTRENVEPICHCVTE-F
A0A670K3Y6_MCL1-01      HLFSDGITNWGRIVTLISFGAFVAKHLKRIN---QESAIGRLAELITEVL
A0A670IB81_BCL2-01      EELFRDGVNWGRIVAFFEFGGMMCVESVSREMSPLVDNI--TVWMTDY-L
A0A670IBZ4_BCL2L1-      NELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI--VSWMTTY-L
A0A670JXJ0_BCL2A1-      QEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTRENVEPICHCVTE-F
A0A670JXJ0_BCL2A1-      VKLASYEEIALLPLTSWNIHQPAENDIREEALS-AAEGLDLILVPGLG-F
                          :          ::   :                   :          :

A0A670JXJ0_BCL2A1-      INTKATWISENGGWVLEHPKYQASQRIAVFLSMSDEVQTEEIIKDIFQHG
A0A670K3Y6_MCL1-01      VTDKREWILNNNAW------------------------------------
A0A670IB81_BCL2-01      NGHLDNWIQDNGGW------------------------------------
A0A670IBZ4_BCL2L1-      TDHLDPWIQENGGW------------------------------------
A0A670JXJ0_BCL2A1-      INTKATWISENGGW------------------------------------
A0A670JXJ0_BCL2A1-      DQTGNRLGRGKGYY------------------------------------
                                  :. :                                    

A0A670JXJ0_BCL2A1-      KECFIPHYKPRSSHMDMVKLASYEEIALLPLTSWNIHQPAENDIREEALS
A0A670K3Y6_MCL1-01      -EGFVNFFHV---------------------------EDVEGSIRSVLMA
A0A670IB81_BCL2-01      --------------------------------------------------
A0A670IBZ4_BCL2L1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
                                                                          

A0A670JXJ0_BCL2A1-      AAEGLDLILVPGLGFDQTGNRLGRGKGYYDTYLNRCRQHPKGKPYTIALA
A0A670K3Y6_MCL1-01      FAG------VAGIG--------------------------AGLAYMIR--
A0A670IB81_BCL2-01      -----------------------------DAFVELYSNNMRP--------
A0A670IBZ4_BCL2L1-      -----------------------------ERFVDLYGNDAAAKSRKGQER
A0A670JXJ0_BCL2A1-      -----------------------------DSFLAKLGE--EKSPWLALHY
A0A670JXJ0_BCL2A1-      -----------------------------DTYLNRCRQHPKGKPYTIALA
                                                                          

A0A670JXJ0_BCL2A1-      FKEQVCDVVPASENDVKVDEILFEDN-----
A0A670K3Y6_MCL1-01      -------------------------------
A0A670IB81_BCL2-01      LFDFSWLPLKTILSLAVVGACITLGAYLGHK
A0A670IBZ4_BCL2L1-      FNKWLW-------TGATVAGVVLLGSLLSRK
A0A670JXJ0_BCL2A1-      IKTKLISAFS-----------FFSQYY----
A0A670JXJ0_BCL2A1-      FKEQVCDVVPASENDVKVDEILFEDN-----
                                                       

© 1998-2021Legal notice