Dataset for protein BCL-2-like of organism Podarcis muralis

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670IB81_BCL2-01      MMAQTGIRGYDTREIVQTYI------------------------------
A0A670IBZ4_BCL2L1-      -------MSRNNRALVVDFV------------------------------
A0A670K3Y6_MCL1-01      MFNKKSVVLYCGGAPSMAPATPVSPGAGGGGSSSGAPTASAAAAAVFTAN
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      MKRLKSL-------------------------------------------
A0A670JXJ0_BCL2A1-      MKRLKSL-------------------------------------------
                                                                          

A0A670IB81_BCL2-01      --------------------------------------------------
A0A670IBZ4_BCL2L1-      --------------------------------------------------
A0A670K3Y6_MCL1-01      GRSEGAGPFSPRIGRGWGASVFPEGPLPRIGSGAPLAGPLARIGPFEVAP
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
                                                                          

A0A670IB81_BCL2-01      ------------------HYKLSQKGYDWVASED--------REDLPSPP
A0A670IBZ4_BCL2L1-      ------------------SYKLSERGHSWDELEEDSENRTELRDEMDSVP
A0A670K3Y6_MCL1-01      RALIGSPAAAAVGGGAARPLALALPEGELDGCDDEAEAQAAQAGDLPSPT
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      ------------------SSALKQPANHLNLHCGGHSLHFALCAHFSMEN
A0A670JXJ0_BCL2A1-      ------------------SSALKQPANHLNLHCGGHSLHFALCAHFSMEN
                                                                          

A0A670IB81_BCL2-01      LPPDPPAAETFPNLARLASHPSELPVSNVAPAGGPHPVPQVVHATLRQAG
A0A670IBZ4_BCL2L1-      NGSPSWHQSTSPVVNGATGHPSILSDLEDSPRLD-------VRQTLREAG
A0A670K3Y6_MCL1-01      PSLESIPSAQGDDDDAAVTLELVSRYLREEAAAS--PGAAQALETLRRVG
A0A670JXJ0_BCL2A1-      --------------------------MESRGEGA--AVSAGDMAALHAAK
A0A670JXJ0_BCL2A1-      NQLQSVDTLVQD----------YLKHVCEDAELD--AAPSRVAQVLARVA
A0A670JXJ0_BCL2A1-      NQLQSVDTLVQD----------YLKHVCEDAELD--AAPSRVAQVLARVA
                                                                    .*  . 

A0A670IB81_BCL2-01      DEFSRRYRRDFAQMSGQLHLTPVTARARF-AAVVEELFRDG-VNWGRIVA
A0A670IBZ4_BCL2L1-      DEFELRYRRAFSDLTSQLHITPGTAYQSF-EQVVNELFRDG-VNWGRIVA
A0A670K3Y6_MCL1-01      DNILDKHQLAFQGMLRKIEIKKEDDLKTV-SEVAKHLFSDGITNWGRIVT
A0A670JXJ0_BCL2A1-      GALRAELKRRLGAL------------------------------------
A0A670JXJ0_BCL2A1-      PSLQEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILT
A0A670JXJ0_BCL2A1-      PSLQEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILT
                          :       :  :                                    

A0A670IB81_BCL2-01      FFEFGGMMCVESVSREMSPLVDNITVWMTDY--LNGHLDNWIQDNGGW--
A0A670IBZ4_BCL2L1-      FFSFGGALCVESVDKEMRVLVGRIVSWMTTY--LTDHLDPWIQENGGW--
A0A670K3Y6_MCL1-01      LISFGAFVAKHLKRINQESAIGRLAELITEV--LVTDKREWILNNNAW--
A0A670JXJ0_BCL2A1-      ------SAAEKLRQSRLV---------------------------RGKVL
A0A670JXJ0_BCL2A1-      IFVFAGIIAKKLRQHGVPLTRENVEPICHCVTEFINTKATWISENGGW--
A0A670JXJ0_BCL2A1-      IFVFAGIIAKKLRQHGVPLTRENVEPICHCVTEFINTKATWISENGGWVL
                                .                                     ..  

A0A670IB81_BCL2-01      -----------------------------------DAFVELYSNNMRP--
A0A670IBZ4_BCL2L1-      -----------------------------------ERFVDLYGNDAAAKS
A0A670K3Y6_MCL1-01      -----------------------------------EGFVNFFHVEDV---
A0A670JXJ0_BCL2A1-      EHPKYQASQRIAVFLSMSDEVQTEEIIKDIFQHGKECFIPHYKPRSSHMD
A0A670JXJ0_BCL2A1-      -----------------------------------DSFLAKLGEEKS---
A0A670JXJ0_BCL2A1-      EHPKYQASQRIAVFLSMSDEVQTEEIIKDIFQHGKECFIPHYKPRSSHMD
                                                           : *:           

A0A670IB81_BCL2-01      ------LFDFSWLPLKTI----------------------LSLAVVGACI
A0A670IBZ4_BCL2L1-      RKGQERFNKWLW-----------------------------TGATVAGVV
A0A670K3Y6_MCL1-01      -----------------------------------EGSIRSVLMAFAGVA
A0A670JXJ0_BCL2A1-      MVKLASYEEIALLPLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFD
A0A670JXJ0_BCL2A1-      --------------------------------------------PWLALH
A0A670JXJ0_BCL2A1-      MVKLASYEEIALLPLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFD
                                                                       .  

A0A670IB81_BCL2-01      TLGAYLGHK-----------------------------------------
A0A670IBZ4_BCL2L1-      LLGSLLSRK-----------------------------------------
A0A670K3Y6_MCL1-01      GIGAGL--------AYMIR-------------------------------
A0A670JXJ0_BCL2A1-      QTGNRLGRGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVVPASENDV
A0A670JXJ0_BCL2A1-      YIKTKLISAFSFFSQYY---------------------------------
A0A670JXJ0_BCL2A1-      QTGNRLGRGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVVPASENDV
                             *                                            

A0A670IB81_BCL2-01      ----------
A0A670IBZ4_BCL2L1-      ----------
A0A670K3Y6_MCL1-01      ----------
A0A670JXJ0_BCL2A1-      KVDEILFEDN
A0A670JXJ0_BCL2A1-      ----------
A0A670JXJ0_BCL2A1-      KVDEILFEDN
                                  

© 1998-2021Legal notice