Dataset for protein BCL-2-like of organism Podarcis muralis

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A670IB81_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Podarcis muralis GN=BCL-2 (length=232 residues).
MMAQTGIRGYDTREIVQTYIHYKLSQKGYDWVASEDREDLPSPPLPPDPPAAETFPNLARLASHPSELPVSNVAPAGGPH
PVPQVVHATLRQAGDEFSRRYRRDFAQMSGQLHLTPVTARARFAAVVEELFRDGVNWGRIVAFFEFGGMMCVESVSREMS
PLVDNITVWMTDYLNGHLDNWIQDNGGWDAFVELYSNNMRPLFDFSWLPLKTILSLAVVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A670IBZ4_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Podarcis muralis GN=BCL2L1 (length=227 residues).
MSRNNRALVVDFVSYKLSERGHSWDELEEDSENRTELRDEMDSVPNGSPSWHQSTSPVVNGATGHPSILSDLEDSPRLDV
RQTLREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRI
VSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAKSRKGQERFNKWLWTGATVAGVVLLGSLLSRK
>gnl|bcl2dbpro|A0A670JXJ0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Podarcis muralis GN=BCL2A1 (length=213 residues).
MESRGEGAAVSAGDMAALHAAKGALRAELKRRLGALSAAEKLRQSRLVRGKVLEHPKYQASQRIAVFLSMSDEVQTEEII
KDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALLPLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFDQTGNRLG
RGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVVPASENDVKVDEILFEDN
>gnl|bcl2dbpro|A0A670JXJ0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Podarcis muralis GN=BCL2A1 (length=337 residues).
MKRLKSLSSALKQPANHLNLHCGGHSLHFALCAHFSMENNQLQSVDTLVQDYLKHVCEDAELDAAPSRVAQVLARVAPSL
QEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTRENVEPICHCVTE
FINTKATWISENGGWVLEHPKYQASQRIAVFLSMSDEVQTEEIIKDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALL
PLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFDQTGNRLGRGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVV
PASENDVKVDEILFEDN
>gnl|bcl2dbpro|A0A670JXJ0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Podarcis muralis GN=BCL2A1 (length=210 residues).
MKRLKSLSSALKQPANHLNLHCGGHSLHFALCAHFSMENNQLQSVDTLVQDYLKHVCEDAELDAAPSRVAQVLARVAPSL
QEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTRENVEPICHCVTE
FINTKATWISENGGWDSFLAKLGEEKSPWLALHYIKTKLISAFSFFSQYY
>gnl|bcl2dbpro|A0A670K3Y6_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Podarcis muralis GN=MCL-1 (length=331 residues).
MFNKKSVVLYCGGAPSMAPATPVSPGAGGGGSSSGAPTASAAAAAVFTANGRSEGAGPFSPRIGRGWGASVFPEGPLPRI
GSGAPLAGPLARIGPFEVAPRALIGSPAAAAVGGGAARPLALALPEGELDGCDDEAEAQAAQAGDLPSPTPSLESIPSAQ
GDDDDAAVTLELVSRYLREEAAASPGAAQALETLRRVGDNILDKHQLAFQGMLRKIEIKKEDDLKTVSEVAKHLFSDGIT
NWGRIVTLISFGAFVAKHLKRINQESAIGRLAELITEVLVTDKREWILNNNAWEGFVNFFHVEDVEGSIRSVLMAFAGVA
GIGAGLAYMIR
© 1998-2020Legal notice