Dataset for protein BCL-2-like of organism Podarcis muralis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m---ks--------------------------------------------------------------------------
-krl--lvsyntrapvvtyvtpvspgaggggsssgaptasaaaaavftangrsegagpfsprigrgwgasvfpegplpri
 mnqtgvrlrdngelsqdpi                                                            
 fak  img cg  i mafa                                                            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------syalsqpgnhlnlheg------alrahlssppnqlqsvdtlv
gsgaplagplarigpfevapraligspaaaavgggaar-sk-k--a--wd--cdghslhf--c-dfpmen---------t
                                      p-- -lr-ys--gs--esenrteq-g------pssppwpss-
                                      hl  aekehe veldeda aqa  aeemd vtlppe phqeq
                                              gd  ac           d       g d iaaa 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  .*  .   :       :  :                          
qd----------ylkhveedaeld--avpsrvaqtLrrvgdslqeeyrrkfkplwhsikitsvteasdi-sqvvaqlfrd
-pvvnravthps----lcvspagsphpa-a-drav aqaapefsrrveeaisqm--qlh-sp-ea---ff---m-ee-a-
s-nldgltslelvssysrsrgrag  --s-vamea he kgnirlklqlrlqg ts---l--g--yqt- ee -n-- - 
g ddaa ag   i rvmnde   a   gaqq l    a   a ld hk d gd srk e kkeddrksv aa akh  s 
f           e pd   a          g h          ea      aa lg         lar      e     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .                                     ..                      
g-tnwgrivtifvfggiiakklrqhgvpltvgnvepwmtcv--lintkdtwisenggw----------------------
-nv-----laf-s-a-svcvesvssemv-lreri--ich-ytef--hla---q--rakvlehpkyqasqriavflsmsde
 i-     ---i- -amm eh krrrqsv-----vv---t-  -vt---p  -n n                        
          l e   fl     dknlrsaid ltsli e    tgd rn  ld                          
                aa      i  ep     ae   d    nd   e                              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               : *:                                                          .  
---------------ecFvplykprss-------------------------------------------lilvpvlgvd
vqteeiikdifqhgkds inhlgnemvhmdmvklasyeeiawlpltswnihqpaendireealsaaegld---avgaafv
                r lekfsvnkrpksrkgqerlnkwsl   kti                 egsirsvg-twg li
                g  df heddaa        ffdfl                              t maf  ch
                a  a     a                                             s       a

       410       420       430       440       450       460
....:....|....:....|....:....|....:....|....:....|....:....|
     *                                                      
qtgnrLgrk------y--------------------------------------------
ylkay --gkgyydt-lnrcrqhpkgkpytialafkeqvcdvvpasendvkvdeilfedn
ti tl ss-fsffsq yi                                          
l  sk iha     a m                                           
g   g                                                       
© 1998-2021Legal notice