Dataset for protein BCL-2-like of organism Podarcis muralis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfnkksvvlycggapsmapatpvspgaggggsssgaptasaaaaavftangrsegagpfsprigrgwgasvfpegplpri
                                                                             mma
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------rkrlkslssglkqpanhtnphcgglsshpsllahfs---
qtgirsyntrarvvtfvvyklsqrgyswvaseggsenrtllm------p-a-d-----l-l----h-l-fa-c----men
gs aplrgpleliqpyisapralk spadelvedgaa pea-elppgv-n-s-swhqs-s-vvnr-t-p--s-svspsaq
    mgadn  i gd eh    ei hd a a d        ldeme pllppppe eeqfaqladapg tpi psln   
                                          ad d e d c d  aa a na   a    e edie   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                .*  .   :       :  :                            
----------------vceraeldavpsrvaqtLrrvgdslqeeyrrkfkplwhsikitsvteasdi-sqvvaqlfrdg-
nqlqsvdtlvqdylkhmspdgg--pa-a-drav aqaapefsrrveeaisqm--qlh-sp-ea---ff---m-ee-a--n
gddddaavtlelvsrylrseldps--s-vamea he kgnirlklqlrlqg ts---l--g--yqt- ee -n-- -  i
                de a agh gaqq l    a   a ld hk d gd srk e kkeddrksv aa akh  s   
                 a    aa    g h          ea      aa lg         lar      e       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                .                                                               
tnwgrivtifvfggiiakklrqhgvp-------------------------------------------------slvvr
v-----laf-s-a-svcvesvssemvltrenvepichcvtefintkatwisenggwvlehpkyqasqriavflsm-degq
-     ---i- -amm eh krrrqs                           r k                   v----
        l e   fl     dknlr                                                 paidn
              aa      i  e                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    :   :      ::     .   :.                                                    
teewitdylqhhkepwiqhnkpwssfvdmysn------------------------------------------------
i-vimktifvtgldcflpnyggrerhmslvklasyeeiallpltswnihqpaendireealsaaegldlilvpglgfdqt
-vssflev tge sn  llhyiktklinffhv                 edv gs  svlmaf g       a i     
ltdl  ak ned re  ae na dg  ea gf                                                
 a       gd       d     a                                                       

       410       420       430       440       450        
....:....|....:....|....:....|....:....|....:....|....:...
                                                          
---------------n------kg--ytia------------a----v-----l----
gnrlgrgkgyydtyl-rcrqhp--kp----lawkeqvcdvvp-svnd-kvlgi-ledn
          fsq ydmrpksra qermnrwsflplktiltl veggcvtdesyfsrk
                aaa     la lfkfl        sg t aa il  a  gh 
                           f d                            
© 1998-2020Legal notice