Dataset for protein BCL-2-like of organism Podarcis muralis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           .                                                    
-------------slv----syklsqpgnhwnlsegg-------------------------------------------
mmaqtgirmyntr---lyyv-sasksrayslvvhcedggsssgaptasaaaaavftangrsegagpfsprigrgwgasvf
       msrrnkmvrvtslh--mmek tpvsplad-                                           
        gkdl ek qkfigap ea  hgadeg                                              
         f k ai  dcg        ed aa                                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   :                   .        
---------------------------------------------hslrfal------------------cahpsmpnpq
pegplprigsgaplagplarigpfevapraligspaaaavgsgar---hlempegeldgcddeaeaqaaqrsvlpsetnw
                                         menltpakgd                   pgpfnrspss
                                         ga are ae                    d e lprlgp
                                              a  d                    a d kg d a

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     .                :   :   .      .       .  
lqsvdt-------------lvqrylkh--elaeldaapsrvaqvlarvvpstlrev--eekikyrwhsikissvlhltpv
hsetspaqgddddaavtlevrsdrtv-vs-dsvvsvsaayq-------arqlqeqagdqfsrrplrrfsqmtkqeeasdi
aeaips             nlnslasrpci-pksnph rqgpstvrq glnmsdkhqt lilqgmlqkgelkgipdyktr
 a afk               aga r    egdaleg kldlhqrpa fhai        ef difdhadecfed i  g
    e                    g      a ed   ga ep i   d          a     a             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :          :          ::   :                   :          :          :. :      
tsq----vvvqeladgntnwgrivtifvfggiiakklrqhgvs-tveni--icwmvte-lintkdtwisenggw------
fayqsfeqmavlffrdgviallplafwsiaqpvcvesvsrempllrsrvepvvhctlyvfvthlarlgqnknyyvlehpk
- rar amdmnk ssyie       sin hammenhikrkn--vqegglgrtsvpidg  tqdgrp  rg  a       
s h    aakh     e        l e   fl  d  eialrpaada dlllelg    ng  nn  ld          
  e       e                    aa     de            a       dd   e              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
yqasqriavflsmsdevqteeiikdifqhgkegfvphykvrsshmdmvklasyeeiallpltswnihqpvensirsvlms
                                c inffhp                           eda gd  eeala
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------dtflnryrq--kgkpytia--fkeqvw-----------v---lflgn----
faggldlilvpglgfdqtgnrlgrgkgyy--yv-lcgnhpap------la----lcdvvpasendvk-dei--ed-ylsr
a e       a i                es--e----nmrksswmgrhylntw--splstiltlav ggvvt--yl gh
                              r  dklsedaealarlaqerifkksilafk   sg t aacilsqs    
                              a  a           k l    df                 f   a    

 
.
 
-
k
 
 
 
© 1998-2021Legal notice