Dataset for protein Bfl1 of organism Podarcis muralis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670JXJ0_BCL2A1-      MKRLKSLSSALKQPANHLNLHCGGHSLHFALCAHFSMENNQLQSVDTLVQ
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      MKRLKSLSSALKQPANHLNLHCGGHSLHFALCAHFSMENNQLQSVDTLVQ
                                                                          

A0A670JXJ0_BCL2A1-      DYLKHVCEDAELDAAPSRVAQVLARVAPSLQEEVEEKIKPLWHSIKISSV
A0A670JXJ0_BCL2A1-      -----MESRGEGAAVSAGDMAALHAAKGALRAELKRRLGAL---------
A0A670JXJ0_BCL2A1-      DYLKHVCEDAELDAAPSRVAQVLARVAPSLQEEVEEKIKPLWHSIKISSV
                             : . .*  *..:    .*  .  :*. *:: .: .*         

A0A670JXJ0_BCL2A1-      EEASDIFSQVMAQEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTREN
A0A670JXJ0_BCL2A1-      ---------------------------------SAAEKLRQSRLV-----
A0A670JXJ0_BCL2A1-      EEASDIFSQVMAQEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTREN
                                                           *:****  :      

A0A670JXJ0_BCL2A1-      VEPICHCVTEFINTKATWISENGGW-------------------------
A0A670JXJ0_BCL2A1-      ----------------------RGKVLEHPKYQASQRIAVFLSMSDEVQT
A0A670JXJ0_BCL2A1-      VEPICHCVTEFINTKATWISENGGWVLEHPKYQASQRIAVFLSMSDEVQT
                                               *.                         

A0A670JXJ0_BCL2A1-      ------------DSFLAKLGEEKS--------------------------
A0A670JXJ0_BCL2A1-      EEIIKDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALLPLTSWNIHQP
A0A670JXJ0_BCL2A1-      EEIIKDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALLPLTSWNIHQP
                                    :.*:.:    .*                          

A0A670JXJ0_BCL2A1-      ---------------------PWLALHYIKTKLISAFSFFSQYY------
A0A670JXJ0_BCL2A1-      AENDIREEALSAAEGLDLILVPGLGFDQTGNRLGRGKGYYDTYLNRCRQH
A0A670JXJ0_BCL2A1-      AENDIREEALSAAEGLDLILVPGLGFDQTGNRLGRGKGYYDTYLNRCRQH
                                             * *.:    ..*  . .::. *       

A0A670JXJ0_BCL2A1-      -------------------------------------
A0A670JXJ0_BCL2A1-      PKGKPYTIALAFKEQVCDVVPASENDVKVDEILFEDN
A0A670JXJ0_BCL2A1-      PKGKPYTIALAFKEQVCDVVPASENDVKVDEILFEDN
                                                             

© 1998-2020Legal notice