Dataset for protein Bfl1 of organism Podarcis muralis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670JXJ0_BCL2A1-      MKRLKSLSSALKQPANHLNLHCGG----HSLHFALCAHFSMENNQLQSVD
A0A670JXJ0_BCL2A1-      MKRLKSLSSALKQPANHLNLHCGG----HSLHFALCAHFSMENNQLQSVD
A0A670JXJ0_BCL2A1-      ----------MESRGEGAAVSAGDMAALHAAKGALRAELKRRLGALSAAE
                                  ::. .:   : .*.    *: : ** * :.   . *.:.:

A0A670JXJ0_BCL2A1-      TLVQDYLKHVCEDAELDAAPSRVAQVLARVAPSLQEEVEEKIKPLWHSIK
A0A670JXJ0_BCL2A1-      TLVQDYLKHVCEDAELD---------------------------------
A0A670JXJ0_BCL2A1-      KLRQSRLVR----GKVL---------------------------------
                        .* *. * .    .::                                  

A0A670JXJ0_BCL2A1-      ISSVEEASDIFSQVMAQEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPL
A0A670JXJ0_BCL2A1-      --------------------------------------------------
A0A670JXJ0_BCL2A1-      --------------------------------------------------
                                                                          

A0A670JXJ0_BCL2A1-      TRENVEPICHCVTEFINTKATWISENGGWVLEHPKYQASQRIAVFLSMSD
A0A670JXJ0_BCL2A1-      -------------------------------AAPSRVAQVLARVAPSLQE
A0A670JXJ0_BCL2A1-      -------------------------------EHPKYQASQRIAVFLSMSD
                                                         *.  *.    *  *:.:

A0A670JXJ0_BCL2A1-      EVQTEEIIKDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALLPLTSWN
A0A670JXJ0_BCL2A1-      EV--EEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILTIFV
A0A670JXJ0_BCL2A1-      EVQTEEIIKDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALLPLTSWN
                        **  ** ** :::  * . :   .   *::   ::*. :      ** : 

A0A670JXJ0_BCL2A1-      IHQPAENDIREEALS-AAEGLDLILVPGLGFDQTGNRLGRGKGYYDTYLN
A0A670JXJ0_BCL2A1-      FAGIIAKKLRQHGVPLTRENVEPICHCVTEFINTKATWISENGGWDSFLA
A0A670JXJ0_BCL2A1-      IHQPAENDIREEALS-AAEGLDLILVPGLGFDQTGNRLGRGKGYYDTYLN
                        :     :.:*: .:. : *.:: *      * :*       :* :*::* 

A0A670JXJ0_BCL2A1-      RCRQHPKGKPYTIALAFKEQVCDVVPASENDVKVDEILFEDN-
A0A670JXJ0_BCL2A1-      KLGE--EKSPWLALHYIKTKLISAFS-----------FFSQYY
A0A670JXJ0_BCL2A1-      RCRQHPKGKPYTIALAFKEQVCDVVPASENDVKVDEILFEDN-
                        .  :  : .*:     :* :: ....           :*.:  

© 1998-2021Legal notice