Dataset for protein Bfl1 of organism Podarcis muralis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          ::. .:   : .*.    *: : ** * :.   . *.:.:.* *. * .    .::              
mkrlkslssalkqpanhlnlhcGg----HslhfALcAhfsmennqLqsvdtLvQdyLkhvcedaeld-------------
----------mesrgegaavsa dmaal aakg  r elkrrlga saaek r sr vr----gkvlaapsrvaqvlarv

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
apslqeeveekikplwhsikissveeasdifsqvmaqefadgntnwgriltifvfagiiakklrqhgvpltrenvepich

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       *.  *.    *  *:.:**  ** ** :::  * . :   .   *::   ::*. : 
---------------------ehPkyqAsqriaVflSmsdEVqtEEiIKdifqhgKecfiphykprsShmdmvklAsyee
cvtefintkatwisenggwvlaa srv qvlar ap lqe  --  k  plwhsi issveeasdif qvmaqef dgnt

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ** : :     :.:*: .:. : *.:: *      * :*       :* :*::* .  :  : .*:     :* :
iallpLTswnihqpaendiReeals-aaEgldlIlvpglgFdqTgnrlgrgkGyyDtyLnrcrqhpkgkPytialafKeq
nwgri  ifvfagiiakkl qhgvpltr nvep chcvte in katwisen gw sf aklge--eks wlalhyi tk

       330       340   
....:....|....:....|...
: ....           :*.:  
vcdvvpasendvkvdeilFedn-
lisafs-----------f sqyy
© 1998-2021Legal notice