Dataset for protein Bfl1 of organism Podarcis muralis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A670JXJ0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Podarcis muralis GN=BCL2A1 (length=213 residues).
MESRGEGAAVSAGDMAALHAAKGALRAELKRRLGALSAAEKLRQSRLVRGKVLEHPKYQASQRIAVFLSMSDEVQTEEII
KDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALLPLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFDQTGNRLG
RGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVVPASENDVKVDEILFEDN
>gnl|bcl2dbpro|A0A670JXJ0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Podarcis muralis GN=BCL2A1 (length=337 residues).
MKRLKSLSSALKQPANHLNLHCGGHSLHFALCAHFSMENNQLQSVDTLVQDYLKHVCEDAELDAAPSRVAQVLARVAPSL
QEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTRENVEPICHCVTE
FINTKATWISENGGWVLEHPKYQASQRIAVFLSMSDEVQTEEIIKDIFQHGKECFIPHYKPRSSHMDMVKLASYEEIALL
PLTSWNIHQPAENDIREEALSAAEGLDLILVPGLGFDQTGNRLGRGKGYYDTYLNRCRQHPKGKPYTIALAFKEQVCDVV
PASENDVKVDEILFEDN
>gnl|bcl2dbpro|A0A670JXJ0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Podarcis muralis GN=BCL2A1 (length=210 residues).
MKRLKSLSSALKQPANHLNLHCGGHSLHFALCAHFSMENNQLQSVDTLVQDYLKHVCEDAELDAAPSRVAQVLARVAPSL
QEEVEEKIKPLWHSIKISSVEEASDIFSQVMAQEFADGNTNWGRILTIFVFAGIIAKKLRQHGVPLTRENVEPICHCVTE
FINTKATWISENGGWDSFLAKLGEEKSPWLALHYIKTKLISAFSFFSQYY
© 1998-2020Legal notice