Dataset for protein BCL-2-like of organism Neovison vison

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C7BMW8_MCL1-01      ---MFGLKRNAVIGLNLYCGG----------------AGLGAGSGGASSS
U6CQS8_BCL2A1-01        --MTDGEFGYTLSLAQDYVRHVLQ------------IPQPGPAASRVSR-
A0A8C7B9K2_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWD-----AGDAGAAPPGAAPA
A0A8C7BPR9_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESE
A0A8C7BPR9_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESE
A0A8C7EW82_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY--------VCGAGPGEGPAAD-
A0A8C7AU04_BCL2L10      --MADALRERTAQLLTDYLEY----------------CARGPGTPARSP-
A0A8C7BMW8_MCL1-02      ---MFGLKRNAVIGLNLYCGG----------------AGLGAGSGGASSS
                                         :                        .       

A0A8C7BMW8_MCL1-01      GGRLLASGKEATARREVGGGEAGAVIGGSAGASTPATLAPDARRVARPSP
U6CQS8_BCL2A1-01        --------------------------------------------------
A0A8C7B9K2_BCL2-01      PGIF----------------------------------------------
A0A8C7BPR9_BCL2L1-      METP----------------------------------------------
A0A8C7BPR9_BCL2L1-      METP----------------------------------------------
A0A8C7EW82_BCL2L2-      --------------------------------------------------
A0A8C7AU04_BCL2L10      --------------------------------------------------
A0A8C7BMW8_MCL1-02      GGRL----------------------------------------------
                                                                          

A0A8C7BMW8_MCL1-01      IGAEGPNVTATPPRLLFFEPTRRASPPEEMEGPAADAIMSPEEELDGYEP
U6CQS8_BCL2A1-01        --------------------------------------------------
A0A8C7B9K2_BCL2-01      --------------------------------------------------
A0A8C7BPR9_BCL2L1-      --------------------------------------------------
A0A8C7BPR9_BCL2L1-      --------------------------------------------------
A0A8C7EW82_BCL2L2-      --------------------------------------------------
A0A8C7AU04_BCL2L10      --------------------------------------------------
A0A8C7BMW8_MCL1-02      --------------------------------------------------
                                                                          

A0A8C7BMW8_MCL1-01      EPLGKRPAVLPLLELVGEASSGPCTDGSLPSTPPPAEEEEDELYRQSLEI
U6CQS8_BCL2A1-01        --------------------------------------------------
A0A8C7B9K2_BCL2-01      --------------------------------------------------
A0A8C7BPR9_BCL2L1-      --------------------------------------------------
A0A8C7BPR9_BCL2L1-      --------------------------------------------------
A0A8C7EW82_BCL2L2-      --------------------------------------------------
A0A8C7AU04_BCL2L10      --------------------------------------------------
A0A8C7BMW8_MCL1-02      --------------------------------------------------
                                                                          

A0A8C7BMW8_MCL1-01      ISRYLREQATGAKDAKPLGGPGAASRKALE------------------TL
U6CQS8_BCL2A1-01        ------------------------------------------------VL
A0A8C7B9K2_BCL2-01      -------SSQPGRTPAPARTSPPPPPAALAAAAAAGPALSPVPPVVHLTL
A0A8C7BPR9_BCL2L1-      -------SAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ-AL
A0A8C7BPR9_BCL2L1-      -------SAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ-AL
A0A8C7EW82_BCL2L2-      --------------------------PLHQ------------------AM
A0A8C7AU04_BCL2L10      ------------------------STREAA------------------VL
A0A8C7BMW8_MCL1-02      -------LATGAKDAKPLGGPGAASRKALE------------------TL
                                                                        .:

A0A8C7BMW8_MCL1-01      RRVGDGVQRNHE------TAFQGMLRKLDI-KNEDDVKSLSRVMVHVFSD
U6CQS8_BCL2A1-01        RDVASSVQREVE------QNLKPCLDSFDVGSIDTARTIFNQVMEKEFED
A0A8C7B9K2_BCL2-01      RQAGDDFSRRYR------RDFAEMSSQLHL-TPFTARGRFATVVEELFRD
A0A8C7BPR9_BCL2L1-      REAGDEFELRYR------RAFSDLTSQLHI-TPGTAYQSFEQVVNELFRD
A0A8C7BPR9_BCL2L1-      REAGDEFELRYR------RAFSDLTSQLHI-TPGTAYQSFEQVVNELFRD
A0A8C7EW82_BCL2L2-      RAAGDEFETRFR------RTFSDLAAQLHV-TPGSAQQRFTQVSDELFQG
A0A8C7AU04_BCL2L10      RSVAADVRQRHERFLSDYRGYRGNRVELVA-QVEREILAHPQAL------
A0A8C7BMW8_MCL1-02      RRVGDGVQRNHE------TAFQGMLRKLDI-KNEDDVKSLSRVMVHVFSD
                        * ..  .                   .:              .       

A0A8C7BMW8_MCL1-01      GVTNWGRIVTLISFGAFVAKH-------------------LKSINQESCI
U6CQS8_BCL2A1-01        GIINWGRIVTVFAFEGILSKK-------------------LLRERISPDV
A0A8C7B9K2_BCL2-01      GV-NWGRIVAFFEFGGVMCVE-------------------SVNREMSPLV
A0A8C7BPR9_BCL2L1-      GV-NWGRIVAFFSFGGALCVE-------------------SVDKEMQALV
A0A8C7BPR9_BCL2L1-      GV-NWGRIVAFFSFGGALCVE-------------------SVDKEMQALV
A0A8C7EW82_BCL2L2-      GP-NWGRLVAFFVFGAALCAE-------------------SVNKEMEPLV
A0A8C7AU04_BCL2L10      ---SWGRVVALLTFAGTLLERPPPGACSNLGPDAELELGEWEATVRQDC-
A0A8C7BMW8_MCL1-02      GVTNWGRIVTLISFGAFVAKH-------------------LKSINQESCI
                           .***:*:.: * . :                            .   

A0A8C7BMW8_MCL1-01      E--PLAESITDVLVRTKRDWLVKQRGW-DGFVEFFHVEDLEGGI------
U6CQS8_BCL2A1-01        DASRVSYFVAEFITTNMREWIRQNGGWEDGFVKKFEP-------------
A0A8C7B9K2_BCL2-01      D--NIALWMTEYLNRHLHTWIQDNGGW-DAFVELYGPSVQPLFDFSWLSL
A0A8C7BPR9_BCL2L1-      S--RIATWMATYLNDHLEPWIQENGGW-DTFVELYGNNAAAESRKGQERF
A0A8C7BPR9_BCL2L1-      S--RIATWMATYLNDHLEPWIQENGGW-VRTGLFYPEFLAHGLRLGK---
A0A8C7EW82_BCL2L2-      G--QVQEWMVAYLETRLADWIHSSGGW-AEFTALYGDGALEEAR------
A0A8C7AU04_BCL2L10      R--RLVDFLCGRLAGQHRAWLEAHGGW-DGFCLFFTPVLLSSWK------
A0A8C7BMW8_MCL1-02      E--PLAESITDVLVRTKRDWLVKQRGW-DGFVEFFHVEDLEGGI------
                            :   :   :      *:    **       :               

A0A8C7BMW8_MCL1-01      -RNVLLAFAGVAG-----------VGAGLAYLIR--
U6CQS8_BCL2A1-01        -KSGWLTFLEVTGKICEMF-----SLLKQYY-----
A0A8C7B9K2_BCL2-01      KALLSLALVGAC------------ITLGAYLGHK--
A0A8C7BPR9_BCL2L1-      NRWFLTGMTVAGV-----------VLLGSLFSRK--
A0A8C7BPR9_BCL2L1-      ------GLASICS-----------VNMKGYY-----
A0A8C7EW82_BCL2L2-      -RLREGNWASVRTVLTGAVALGALVTVGAFFASK--
A0A8C7AU04_BCL2L10      -RLLVQALLSCFT-----------AVILIYFWKRLP
A0A8C7BMW8_MCL1-02      -RNVLLAFAGVAG-----------VGAGLAYLIR--
                                                            

© 1998-2022Legal notice