Dataset for protein BCL-2-like of organism Neovison vison

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C7AU04_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Neovison vison GN=BCL2L10 (length=193 residues).
MADALRERTAQLLTDYLEYCARGPGTPARSPSTREAAVLRSVAADVRQRHERFLSDYRGYRGNRVELVAQVEREILAHPQ
ALSWGRVVALLTFAGTLLERPPPGACSNLGPDAELELGEWEATVRQDCRRLVDFLCGRLAGQHRAWLEAHGGWDGFCLFF
TPVLLSSWKRLLVQALLSCFTAVILIYFWKRLP
>gnl|bcl2dbpro|A0A8C7B9K2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Neovison vison GN=BCL-2 (length=234 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPARTSPPPPPAALAAAAAAGPA
LSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNRE
MSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSVQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C7BMW8_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neovison vison GN=MCL-1 (length=197 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLATGAKDAKPLGGPGAASRKALETLRRVGDGVQRNHETAFQGMLR
KLDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWD
GFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C7BMW8_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Neovison vison GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATARREVGGGEAGAVIGGSAGASTPATLAPDARRVARPS
PIGAEGPNVTATPPRLLFFEPTRRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPCTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGPGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C7BPR9_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Neovison vison GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ALVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C7BPR9_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Neovison vison GN=BCL2L1 (length=221 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
ALVSRIATWMATYLNDHLEPWIQENGGWVRTGLFYPEFLAHGLRLGKGLASICSVNMKGYY
>gnl|bcl2dbpro|A0A8C7EW82_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Neovison vison GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|U6CQS8_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Neovison vison GN=BCL2A1 (length=174 residues).
MTDGEFGYTLSLAQDYVRHVLQIPQPGPAASRVSRVLRDVASSVQREVEQNLKPCLDSFDVGSIDTARTIFNQVMEKEFE
DGIINWGRIVTVFAFEGILSKKLLRERISPDVDASRVSYFVAEFITTNMREWIRQNGGWEDGFVKKFEPKSGWLTFLEVT
GKICEMFSLLKQYY
© 1998-2022Legal notice