Dataset for protein BCL-2-like of organism Neovison vison

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 :                        .                                     
-----glsrstrelvvdylgykl--------------egrgpgpggass-------------------------------
mmmtf-mkqnnviglnlfvsg--sqkgyswsqfsdaecnltaasprtepsmgtplasgkeatarrevgggeagaviggsa
 ahmdatrydalsiatk crhv r r  e d     vaqa e tepvaregerl                          
  aaprsgpy aq  q  ih   q            ipdp   esar dap if                          
    g efgr  a  m   e                aga    a                                    
       ae      a                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gastpatlapdarrvarpspigaegpnvtatpprllffeptrrasppeemegpaadaimspeeeldgyepeplgkrpavl
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------a--------l----a-s-aalh----------
pllelvgeassgpctdgslpstpppaeeeedelyrqsleiisrylres-tngnpswp-ggsp-v-rktgesssldarevi
                                               qsigakdakhaadpgpang---aaaaaagpals
                                               l qp rtpa  rt   pptrlh-          
                                                                 ppeaq          
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .:* ..  .                   .:              .          .***:*:.: * . :  
--------tlRrvgdevqrryr------rafsgmlsqlhi-tpgtayqsfsqvvvelfrdgv-nWGRiVaffsFggalcv
pmaavkqlam eaasgfelnherflsdyttyqdltrkfdvgkneddvkrleramnhv-s---ts   v tliv eafvak
 vpp vh v  s  ad stev       qnlrpnsvs vl svfsertihtt se-- -g pi    l  vlt a vmse
           q   s rq f        g kecrde  a qidr qla p  l-ke q  i          e   t la
           d                 d a  aa          ig  n   d   e             a   i   
           a                                      a                             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          .       :   :   :      *:    **       :               
e-------------------svskemqplvs--rlaewmttylnrhlrdWiqkngGW-dgfvefygpelleggr------
hpppgacsnlgpdaelelgelkninqescieaspivtsiaevivttkep lveqr  evtttllfhv-da-e-ilgwlsl
r                   wldtvrsad-d  qvsyfvvdr tdrmht  rss    ar gkk tnva-s-w-ksqerf
k                    errri d  r  n ql lcgf egqhae  hqh     e ca  pes-qpsskf k   
                      ae      g     d   a  a n  a  ed      a     ednv hlld      
                                                    a              g  a f       
                                                                   f    a       

       410       420       430      
....:....|....:....|....:....|....:.
                                    
-rlvllalasvcg-----------vtlglyy--r--
n-nl--gflgaatvltgmvalgalslakaafliklp
kk--wttwvvit-kiceaf     igvlsllws-  
 awrvqnmtecrv           avm qf sr   
  sgsg     gs            ni i  gk   
   fe      f                g  ah   
                                    
© 1998-2022Legal notice