Dataset for protein Mcl-1 of organism Lates calcarifer

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W6CDF4_MCL1-03      MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGN
A0A4W6CDF4_MCL1-02      MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGN
A0A4W6CDF4_MCL1-01      MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGN
                        **************************************************

A0A4W6CDF4_MCL1-03      VGSPKRPKNLEVSSTNGYPAKSRLEDSDVDDGSLPCTPELQSDSEIDVSS
A0A4W6CDF4_MCL1-02      VGSPKRPKNLEVSSTNGYPAKSRLEDSDVDDGSLPCTPELQSDSEIDVSS
A0A4W6CDF4_MCL1-01      VGSPKRPKNLEVSSTNGYPAKSRLEDSDVDDGSLPCTPELQSDSEIDVSS
                        **************************************************

A0A4W6CDF4_MCL1-03      CPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEK
A0A4W6CDF4_MCL1-02      CPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEK
A0A4W6CDF4_MCL1-01      CPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEK
                        **************************************************

A0A4W6CDF4_MCL1-03      HRYAYNGMINKLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGA
A0A4W6CDF4_MCL1-02      HRYAYNGMINKLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGA
A0A4W6CDF4_MCL1-01      HRYAYNGMINKLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGA
                        **************************************************

A0A4W6CDF4_MCL1-03      VVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSWDGFVEFFHVS
A0A4W6CDF4_MCL1-02      VVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSWDGFVEFFHVS
A0A4W6CDF4_MCL1-01      VVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSWDGFVEFFHVS
                        **************************************************

A0A4W6CDF4_MCL1-03      DPESTVRNTLIGLAGFAGIGATLALLISNYPAARVFVCKAKAGRESCIFP
A0A4W6CDF4_MCL1-02      DPESTVRNTLIGLAGFAGIGATLALLIRSS---RCLGLQDKHNTHRGLRR
A0A4W6CDF4_MCL1-01      DPESTVRNTLIGLAGFAGIGATLALLIRSF---CEFG--------SGLKS
                        *************************** .      :           :  

A0A4W6CDF4_MCL1-03      CLAVMKPISIEPIDKPRIICMDSTL
A0A4W6CDF4_MCL1-02      KWSRASPW-----------------
A0A4W6CDF4_MCL1-01      FILPHG-------------------
                                                 

© 1998-2020Legal notice