Dataset for protein Mcl-1 of organism Lates calcarifer

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A4W6CDF4_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lates calcarifer GN=MCL-1 (length=305 residues).
MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGNVGSPKRPKNLEVSSTNGYPAKSRLEDSDVD
DGSLPCTPELQSDSEIDVSSCPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEKHRYAYNGMIN
KLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGAVVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSW
DGFVEFFHVSDPESTVRNTLIGLAGFAGIGATLALLIRSSRCLGLQDKHNTHRGLRRKWSRASPW
>gnl|bcl2dbpro|A0A4W6CDF4_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lates calcarifer GN=MCL-1 (length=295 residues).
MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGNVGSPKRPKNLEVSSTNGYPAKSRLEDSDVD
DGSLPCTPELQSDSEIDVSSCPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEKHRYAYNGMIN
KLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGAVVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSW
DGFVEFFHVSDPESTVRNTLIGLAGFAGIGATLALLIRSFCEFGSGLKSFILPHG
>gnl|bcl2dbpro|A0A4W6CDF4_MCL1-03 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Lates calcarifer GN=MCL-1 (length=325 residues).
MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGNVGSPKRPKNLEVSSTNGYPAKSRLEDSDVD
DGSLPCTPELQSDSEIDVSSCPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEKHRYAYNGMIN
KLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGAVVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSW
DGFVEFFHVSDPESTVRNTLIGLAGFAGIGATLALLISNYPAARVFVCKAKAGRESCIFPCLAVMKPISIEPIDKPRIIC
MDSTL
© 1998-2020Legal notice