Dataset for protein Mcl-1 of organism Lates calcarifer

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MNIIPTTKRTALMNCFILPQNGVAEGLHYSSGDSSPQIAMGSTIDSRNGNVGSPKRPKNLEVSSTNGYPAKSRLEDSDVD
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
DGSLPCTPELQSDSEIDVSSCPAGDEVLENDTRQLISQFMRDFTGLSKPRWNKSKALPTMKRVVDGVLEKHRYAYNGMIN
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
KLSLDDRGDDVSFVSVVAKNLFGDGTTNWGRIASLVAFGAVVCQHLKERGRVDCVDLVGQEIATYLLSDQRDWLVKNNSW
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************* .      :           :                      
DGFVEFFHVSDPESTVRNTLIGLAGFAGIGATLALLIrsy---rvfg---k----sglrskwsvmsp-------------
                                     snspaacelvlqd-hnthrcikrfllrhk-wsiepidkpriic
                                       f    c  cka agre   fpciapag i            

     
....:
     
-----
mdstl
     
© 1998-2020Legal notice