Dataset for protein Bcl-2 of organism Falco tinnunculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4U538_BCL2-01      QRNIFIVQAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGL
A0A8C4U538_BCL2-02      -------MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPLPPGL
                                ******************************************

A0A8C4U538_BCL2-01      SPPAAAAAVAAAAAAGTSSDHTGLVSPHPEPPGSAAASHVPPAEGLRPAP
A0A8C4U538_BCL2-02      SPPAAAAAVAAAAAAGTSSDHTGLVSPHPEPPGSAAASHVPPAEGLRPAP
                        **************************************************

A0A8C4U538_BCL2-01      QVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRD
A0A8C4U538_BCL2-02      QVVHLTLRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRD
                        **************************************************

A0A8C4U538_BCL2-01      GVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQ
A0A8C4U538_BCL2-02      GVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIAAWMTEYLNRHLHNWIQ
                        **************************************************

A0A8C4U538_BCL2-01      DNGGW----------VRPPIARSLSWLW------------CTASGAPGWA
A0A8C4U538_BCL2-02      DNGGWDAFVELYGNSMRPLF--DFSWISLKTILSLVLVGACITLGAYLGH
                        *****          :** :  .:**:             * : **    

A0A8C4U538_BCL2-01      V
A0A8C4U538_BCL2-02      K
                         

© 1998-2023Legal notice